Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000021556 (Golm1)
Chromosomal location
Chr 13: 59736357 - 59777145 (-)
Description
golgi membrane protein 1 Gene [Source:MGI Symbol;Acc:MGI:1917329]
RefSeq_dna
NM_001035122 NM_027307 
RefSeq_peptide
NP_081583.3 NP_001030294.1 
UniGene
Mm.409995 Mm.417322 Mm.171335 
MGI
MGI:1917329 
Uniprot/SWISSPROT
Q91XA2 
Uniprot/SPTREMBL
Q3TIZ8 Q3UZG0 Q4KMM5 
Human Ortholog
ENSG00000135052 (GOLM1)
Omim not available
UniTrap UNI10568
Vector Insertion
Chr 13: 59776458 - 59777087
Public Clones G084F04 (ggtc) (ggtc) IST14971B3 (tigm)
Private Clones OST280742 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI19627
Vector Insertion
Chr 13: 59767038 - 59776321
Public Clones (sanger) E051E12 (ggtc) D108G04 (ggtc) CMHD-GT_271A12-3 (cmhd) IST11547E7 (tigm)
IST14160C12 (tigm) IST12206A2 (tigm) IST14351B8 (tigm) IST14390A5 (tigm)
IST14561C1 (tigm)
Private Clones OST385873 (lexicon) OST325285 (lexicon) OST322701 (lexicon) OST285033 (lexicon)
OST274688 (lexicon) OST153219 (lexicon) OST98837 (lexicon) OST85054 (lexicon)
OST82938 (lexicon) OST68507 (lexicon) OST67863 (lexicon) OST34168 (lexicon)
OST32209 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI10593
Vector Insertion
Chr 13: 59765739 - 59766887
Public Clones G041F02 (ggtc) P071G06 (ggtc) P069F08 (ggtc) G081C05 (ggtc) P085G05 (ggtc)
G052E03 (ggtc) P073H01 (ggtc) P085B12 (ggtc) G085A02 (ggtc) P071A11 (ggtc)
P069G05 (ggtc) G075E07 (ggtc) P076F01 (ggtc) G050A02 (ggtc) P072E10 (ggtc)
(ggtc) G085C01 (ggtc) P084E06 (ggtc) G062C05 (ggtc) G066D12 (ggtc)
P083E02 (ggtc)
Private Clones OST260400 (lexicon)
Severity of mutation (?) Insertion after 11% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI10509
Vector Insertion
Chr 13: 59752112 - 59765558
Public Clones G040D08 (ggtc) P071E08 (ggtc) P077F01 (ggtc) P072H07 (ggtc) G081H05 (ggtc)
P075G11 (ggtc) G034C10 (ggtc) (ggtc) P086C05 (ggtc) P073D10 (ggtc)
P085G06 (ggtc) G085G03 (ggtc) M092B03 (ggtc) G067E06 (ggtc) P070B10 (ggtc)
G067B04 (ggtc) P080D12 (ggtc) G052B09 (ggtc) P072B06 (ggtc) P085B11 (ggtc)
G079C08 (ggtc) P076A07 (ggtc) G048D05 (ggtc) P082A11 (ggtc) P069C05 (ggtc)
P086G03 (ggtc) CMHD-GT_411H11-3 (cmhd) PST20764-NR (escells) IST14963E4 (tigm)
IST14377C1 (tigm) IST14315F7 (tigm) IST12126F4 (tigm)
Private Clones OST422604 (lexicon) OST420243 (lexicon) OST413162 (lexicon) OST395738 (lexicon)
OST344925 (lexicon) OST339388 (lexicon) OST309447 (lexicon) OST252172 (lexicon)
OST249739 (lexicon) OST175528 (lexicon)
Severity of mutation (?) Insertion after 26% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI10609
Vector Insertion
Chr 13: 59751027 - 59752056
Public Clones P069B02 (ggtc) G031C04 (ggtc) M090E06 (ggtc) CMHD-GT_364G1-3 (cmhd)
Private Clones OST365258 (lexicon) OST230500 (lexicon) OST220642 (lexicon) OST198517 (lexicon)
Severity of mutation (?) Insertion after 31% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI10611
Vector Insertion
Chr 13: 59746584 - 59750923
Public Clones P069A10 (ggtc) M098D01 (ggtc) CMHD-GT_504G3-3 (cmhd) CMHD-GT_474C9-3 (cmhd)
CMHD-GT_535G12-5S (cmhd) CMHD-GT_306G5-3 (cmhd) IST13045F10 (tigm)
Private Clones OST453875 (lexicon) OST447998 (lexicon) OST422419 (lexicon)
Severity of mutation (?) Insertion after 39% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI13309
Vector Insertion
Chr 13: 59743749 - 59746453
Public Clones CMHD-GT_336E9-3 (cmhd)
Private Clones OST390671 (lexicon) OST335799 (lexicon)
Severity of mutation (?) Insertion after 51% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI10274
Vector Insertion
Chr 13: 59741703 - 59743603
Public Clones KST273 (baygenomics) KST288 (baygenomics)
Private Clones OST238454 (lexicon)
Severity of mutation (?) Insertion after 63% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI25223
Vector Insertion
Chr 13: 59738763 - 59739665
Public Clones not available
Private Clones OST191329 (lexicon)
Severity of mutation (?) Insertion after 91% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000022039
Sequence
AGACGTCCTCGGCAGAGACCGCGCGGACGAGCGGACGGAGCGCCTCGCTGCCCCGCAG - UNI10568 - - UNI19627 - GTTCTCGGCCCTGGT

TCTAAGATGATGGGATTGGGGAATGGGCGTCGCAGCATGAAGTCTCCGCCCCTTATCCTGGCTGCCCTGGTGGCCTGTGTTATTGTGCTAGGCTTCAACT

ACTGGATTGCTAGCTCGAGAAGCGTGGAACTCCAG - UNI10593 - ACGCGCATTGTAGAGCTGGAAGGCCGGGTCCGCAGGGCGGCTGCAGAGAGA

GGTGCTGTAGAGCTCAAGAAGAATGAGTTCCAGGGCGAGCTGCAGAAGCAGAGAGAGCAACTTGACAGGATCCAGTCTAGCCACAGCTTCCAGCTGGAGA

ATGTCAACAAGCTACACCAGGATGAGAAG - UNI10509 - GCGGTTTTAGTGAATAACATCACCACAGGCGAGAAGCTCATTCGAGACCTGCAAG -

 UNI10609 - ACCAGTTGAAGGCACTGCAGAGGAGTTACAGCAGCCTGCAGCAGGATATCTTCCAATTCCAGAAGAACCAGACCAGCCTGGAGAAGAA

GTTCTCCTATGACCT - UNI10611 - GAACCAGTGTATCAGCCAGATGACCGAGGTGAAGGAACAGTGTGACGAGCGGATAGAGGAGGTCATCAGAA

AGCGAAACGAAGCACCGGGTTCCAGAGACCTGGCTGAAACCAACAACCAACATCAGCAG - UNI13309 - GCCCTCAAGCCTCAGCCCAAGCTTCAG

GAAGAAGTCCCATCAGAGGAACAGATGCCACAAGAGAAAGGGGATGTGCCCAGAAACAAGTCCCAGATTCCAGCCCCCAATTCAGAGAGCTTGGGTTTGA

AGCCACAGGTGCAGAATG - UNI10274 - AGGAAACCAATGAGATTCAGGCTGTCGGTGAGGAGCACCAACAGGCATCCATCCAAGGGCAGGCGGTG

GCGGATGGCACTCGGGTAGGAGCTGAGAAACTCGATCAGCACACACAGCTACCAGCTGGCCTGTTGGCCAGGCCTGAGGAGGACTCTCAGTACCCTGAGC

GGGAGCAGCTTGTCATCCGGGATAGGCAGGAGCAGCAGCGTGCATCAGAGGAAG GGGGAGGCCAGAAGAACCCAGGAGATGAATACGACATGGATGAAA

ACGAAGCAGAATCTGAGAGGGAGAAGCAGGCAGCCCTTGCAGGGAATGACAGAAATATAAATG - UNI25223 - TTCTTAATGCTGACGCTCAGAAG

AGAGGCATAATAAATGTGCCCGTCGGGAGTGAAAGGCAGAGCCACATTCTAAATCAAGTAGGCATTCATATTCCTCAACAAGCCTGAAGAGATCCTACGG

GGGTTCACTGTGACTCAACTGTGAAATGGACAGCGAAATGAACGTCGGCCCATTATTGTGGGGTTTAATCAGTACATTTTGCAAAGAAAAAAAAATGGGA

CCATCTCAGACAGTTTGGGGGTACTTTTAAAGTGTCTACAAGAGATGTCAAAATTGATCAAGCTTTGATTAACAGGTATTTCTTAAGCAGGTCAACACCA

AAAAGAGAAATGAGGCTGTCCTGTCTAGGCAGCAGCACCTCCTCACCCTGCAGTGTAAGACAGAGTAGACTGAGGGCAGCTGCTGGCCACAGCGGCTCCC

TCCTTGTGCTGCCGCTTGCCAGTTTCTGTCCACAGATATTAAGTAGCTCATCACTCCTGCACACACTTGATTCCACCATCAATGGCCTAGAGCTCTTACC

GTCAGCATAAACACCACTAGTCAGTTCTATACAAAAGCTGTTCTGTGCAAAAACTGCATTAATTAAAAGACAGCCACCATATCTGGCTTACTTCAGGATT

CGGAAGGCTGAGGCAGGAGATTGCTGCAAGTTCTGAGCCAGCCTAAAGCAACATAGTGAGTGCCAAGCTAAGATGAGCAAGAATGAAAGCCCCTGTCTCA

AATATCAGTGAGAGTTGTTACTTTAAAAAAGACTGGTTTAAATAACCTTCATTATTCTTTTGATGTACAGAACACTATGAAGTTACTGACAATGCGAGCA

CCTATGGTCTGTGTTTGTTTGATTGGGCAGAGTTTCTAGTAAGTCACTCATCTCACTAAGAAAGGCAGTGCCTGCACTGCGCTCTGGACAAAGGCTGCAT

GGGCAGAGGTGTCCAAGAGGAAGGGTTGGCTGCTGGAGGATACTCAGGTTTCAAGCTGGATTCCTACGAAGGCAAGAGCAACACGAGCTGTTTTTCCCAA

GTTTATATACTGTTTGAAAAACACACAAGGTGAATGTTAGTTTTGAAAGATTTGTAGTTCATTGATGGTAATGCATCGTAAGTCTTGATTCCGATCAGCA

GCTTCTGATTGCAGACTGACTGCAGTCACACTGACGACTCGTTCCAGAAACGATCTCTCTGAAGAGTGGCTGATCTGACTCTGAAGTGCTGGCTAAATAG

GAAGCAGCAGCACTAGAGGCACAGGGGCTGAAGATCCCTGCAGTGAAGTGGATGCCGGGTGGTCCAGCTGTCTGTGCCTCTTTAAAGCACACATTTAAAC

CCCTATGGCAGACGTGGGTTGTTTCTCACTGCAGAACTACCCAGTTCTACCCCATGTTTAGATGAGTACTGTTTAATGTCACAAGCCATTTTCCTTTACA

CTTTAACTTGCCAGAGCCTCAGATGGACTGTTCTTACACCTTTTCTGCTCCTAGGTCCCAAACTCAAGGGGACTTTGTATTTCTAGTGCTTGTTTTCTAC

CTTAATCTGGTTTGGGTTTAAAGTGTAGATATTGCTGACAGGCTGTGCTGATTTCCTTTTTAACAAGTACAATAGGTAAGGGCCACATTCTACCCTTTGG

GTTCTAAGATTCCAGGGTACCAATAGCCATGCATGACAGCTGAGCCATACCACCTCCGTACTGACCAGGAAGTAACCAACATCCTGTCTTCGCTAGCATC

TTGATCAAGTCCAGTCAGGCATGCTTCAGTGTTTCTAGGAAATGGAAGGTGCCACAGGGTTGGGCTGGCATAGCTCCGTGAGAACTTCTACCTAGCCAGT

ATGTGTGAGTCCCTGGGTCGCATCCTCAGCACCAACGAACACTGTCACATTAGAGTTAGGCCACTGAAATCTTAGAGTCATTTTTGCTGTAAGCCAAATG

AACTAGCAATAGTCAGGCCAAACCACAAAGCCAGATTGAATTTCAGGGTGGCTCACTCTGCTAAAAGCACTGCCCCTTCAGAGTACAAATGGGAAACCCC

ACGGGCTTAGACAGTTGTCACAGCACACCAGTGACAAGACCAGCAGAGGAATGAGCAGCAAATCAAGGATGGGGTCTCTTGCTGGTGGCCAAGAACAAAA

CCTACACCTCAGGGCACTTGGGACTTCAGCTGGAACAAAGGGATGCACCACTTTCCAACAAGACCTGAAACTCAGCGGCCTACAAACTCCTACCTGATAC

CAGCAGCAGACACTGCAGTGTGATGTGGTTTTCCTTCAACTGCATGACTAAAGACCCTTAGAAATCTGTGTCACAACACAGTCACAATCCTCATGTACTT

TAGCGATCCTCTTACCTCAAAATCAATTTGTAATTTGACCAGAATCTTAAATCCTTAATAAATCTTGTGTTTTGAAACTTCAA
Translation
 - UNI10568 - - UNI19627 - MMGLGNGRRSMKSPPLILAALVACVIVLGFNYWIASSRSVELQ - UNI10593 - TRIVELEGRVRRAAAE

RGAVELKKNEFQGELQKQREQLDRIQSSHSFQLENVNKLHQDEK - UNI10509 - AVLVNNITTGEKLIRDLQD - UNI10609 - DQLKALQRS

YSSLQQDIFQFQKNQTSLEKKFSYDL - UNI10611 - LNQCISQMTEVKEQCDERIEEVIRKRNEAPGSRDLAETNNQHQQ - UNI13309 - AL

KPQPKLQEEVPSEEQMPQEKGDVPRNKSQIPAPNSESLGLKPQVQNE - UNI10274 - EETNEIQAVGEEHQQASIQGQAVADGTRVGAEKLDQHTQ

LPAGLLARPEEDSQYPEREQLVIRDRQEQQRASEEG GGGQKNPGDEYDMDENEAESEREKQAALAGNDRNINV - UNI25223 - VLNADAQKRGII

NVPVGSERQSHILNQVGIHIPQQA
Transcript ENSMUST00000095739
Sequence
AGACGTCCTCGGCAGAGACCGCGCGGACGAGCGGACGGAGCGCCTCGCTGCCCCGCAG - UNI10568 - GAACATTCGTTCTTCAGGAGCGGGAGTG

GAGTGACGTGCACACCAGTTTGCTGAGCCGCTTAGCGCAGTGCAATGGCTGAGCGTGTATGAATGGCCATCTCTTGGGTCGCTTGGACAGTTAGTTGTAT

TTCCGAAG - UNI19627 - GTTCTCGGCCCTGGTTCTAAGATGATGGGATTGGGGAATGGGCGTCGCAGCATGAAGTCTCCGCCCCTTATCCTGGCT

GCCCTGGTGGCCTGTGTTATTGTGCTAGGCTTCAACTACTGGATTGCTAGCTCGAGAAGCGTGGAACTCCAG - UNI10593 - ACGCGCATTGTAGA

GCTGGAAGGCCGGGTCCGCAGGGCGGCTGCAGAGAGAGGTGCTGTAGAGCTCAAGAAGAATGAGTTCCAGGGCGAGCTGCAGAAGCAGAGAGAGCAACTT

GACAGGATCCAGTCTAGCCACAGCTTCCAGCTGGAGAATGTCAACAAGCTACACCAGGATGAGAAG - UNI10509 - GCGGTTTTAGTGAATAACAT

CACCACAGGCGAGAAGCTCATTCGAGACCTGCAAG - UNI10609 - ACCAGTTGAAGGCACTGCAGAGGAGTTACAGCAGCCTGCAGCAGGATATCT

TCCAATTCCAGAAGAACCAGACCAGCCTGGAGAAGAAGTTCTCCTATGACCT - UNI10611 - GAACCAGTGTATCAGCCAGATGACCGAGGTGAAG

GAACAGTGTGACGAGCGGATAGAGGAGGTCATCAGAAAGCGAAACGAAGCACCGGGTTCCAGAGACCTGGCTGAAACCAACAACCAACATCAGCAG - U

NI13309 - GCCCTCAAGCCTCAGCCCAAGCTTCAGGAAGAAGTCCCATCAGAGGAACAGATGCCACAAGAGAAAGGGGATGTGCCCAGAAACAAGTCC

CAGATTCCAGCCCCCAATTCAGAGAGCTTGGGTTTGAAGCCACAGGTGCAGAATG - UNI10274 - AGGAAACCAATGAGATTCAGGCTGTCGGTGA

GGAGCACCAACAGGCATCCATCCAAGGGCAGGCGGTGGCGGATGGCACTCGGGTAGGAGCTGAGAAACTCGATCAGCACACACAGCTACCAGCTGGCCTG

TTGGCCAGGCCTGAGGAGGACTCTCAGTACCCTGAGCGGGAGCAGCTTGTCATCCGGGATAGGCAGGAGCAGCAGCGTGCATCAGAGGAAG GGGGAGGC

CAGAAGAACCCAGGAGATGAATACGACATGGATGAAAACGAAGCAGAATCTGAGAGGGAGAAGCAGGCAGCCCTTGCAGGGAATGACAGAAATATAAATG

 - UNI25223 - TTCTTAATGCTGACGCTCAGAAGAGAGGCATAATAAATGTGCCCGTCGGGAGTGAAAGGCAGAGCCACATTCTAAATCAAGTAGGC

ATTCATATTCCTCAACAAGCCTGAAGAGATCCTACGGGGGTTCACTGTGACTCAACTGTGAAATGGACAGCGAAATGAACGTCGGCCCATTATTGTGGGG

TTTAATCAGTACATTTTGCAAAGAAAAAAAAATGGGACCATCTCAGACAGTTTGGGGGTACTTTTAAAGTGTCTACAAGAGATGTCAAAATTGATCAAGC

TTTGATTAACAGGTATTTCTTAAGCAGGTCAACACCAAAAAGAGAAATGAGGCTGTCCTGTCTAGGCAGCAGCACCTCCTCACCCTGCAGTGTAAGACAG

AGTAGACTGAGGGCAGCTGCTGGCCACAGCGGCTCCCTCCTTGTGCTGCCGCTTGCCAGTTTCTGTCCACAGATATTAAGTAGCTCATCACTCCTGCACA

CACTTGATTCCACCATCAATGGCCTAGAGCTCTTACCGTCAGCATAAACACCACTAGTCAGTTCTATACAAAAGCTGTTCTGTGCAAAAACTGCATTAAT

TAAAAGACAGCCACCATATCTGGCTTACTTCAGGATTCGGAAGGCTGAGGCAGGAGATTGCTGCAAGTTCTGAGCCAGCCTAAAGCAACATAGTGAGTGC

CAAGCTAAGATGAGCAAGAATGAAAGCCCCTGTCTCAAATATCAGTGAGAGTTGTTACTTTAAAAAAGACTGGTTTAAATAACCTTCATTATTCTTTTGA

TGTACAGAACACTATGAAGTTACTGACAATGCGAGCACCTATGGTCTGTGTTTGTTTGATTGGGCAGAGTTTCTAGTAAGTCACTCATCTCACTAAGAAA

GGCAGTGCCTGCACTGCGCTCTGGACAAAGGCTGCATGGGCAGAGGTGTCCAAGAGGAAGGGTTGGCTGCTGGAGGATACTCAGGTTTCAAGCTGGATTC

CTACGAAGGCAAGAGCAACACGAGCTGTTTTTCCCAAGTTTATATACTGTTTGAAAAACACACAAGGTGAATGTTAGTTTTGAAAGATTTGTAGTTCATT

GATGGTAATGCATCGTAAGTCTTGATTCCGATCAGCAGCTTCTGATTGCAGACTGACTGCAGTCACACTGACGACTCGTTCCAGAAACGATCTCTCTGAA

GAGTGGCTGATCTGACTCTGAAGTGCTGGCTAAATAGGAAGCAGCAGCACTAGAGGCACAGGGGCTGAAGATCCCTGCAGTGAAGTGGATGCCGGGTGGT

CCAGCTGTCTGTGCCTCTTTAAAGCACACATTTAAACCCCTATGGCAGACGTGGGTTGTTTCTCACTGCAGAACTACCCAGTTCTACCCCATGTTTAGAT

GAGTACTGTTTAATGTCACAAGCCATTTTCCTTTACACTTTAACTTGCCAGAGCCTCAGATGGACTGTTCTTACACCTTTTCTGCTCCTAGGTCCCAAAC

TCAAGGGGACTTTGTATTTCTAGTGCTTGTTTTCTACCTTAATCTGGTTTGGGTTTAAAGTGTAGATATTGCTGACAGGCTGTGCTGATTTCCTTTTTAA

CAAGTACAATAGGTAAGGGCCACATTCTACCCTTTGGGTTCTAAGATTCCAGGGTACCAATAGCCATGCATGACAGCTGAGCCATACCACCTCCGTACTG

ACCAGGAAGTAACCAACATCCTGTCTTCGCTAGCATCTTGATCAAGTCCAGTCAGGCATGCTTCAGTGTTTCTAGGAAATGGAAGGTGCCACAGGGTTGG

GCTGGCATAGCTCCGTGAGAACTTCTACCTAGCCAGTATGTGTGAGTCCCTGGGTCGCATCCTCAGCACCAACGAACACTGTCACATTAGAGTTAGGCCA

CTGAAATCTTAGAGTCATTTTTGCTGTAAGCCAAATGAACTAGCAATAGTCAGGCCAAACCACAAAGCCAGATTGAATTTCAGGGTGGCTCACTCTGCTA

AAAGCACTGCCCCTTCAGAGTACAAATGGGAAACCCCACGGGCTTAGACAGTTGTCACAGCACACCAGTGACAAGACCAGCAGAGGAATGAGCAGCAAAT

CAAGGATGGGGTCTCTTGCTGGTGGCCAAGAACAAAACCTACACCTCAGGGCACTTGGGACTTCAGCTGGAACAAAGGGATGCACCACTTTCCAACAAGA

CCTGAAACTCAGCGGCCTACAAACTCCTACCTGATACCAGCAGCAGACACTGCAGTGTGATGTGGTTTTCCTTCAACTGCATGACTAAAGACCCTTAGAA

ATCTGTGTCACAACACAGTCACAATCCTCATGTACTTTAGCGATCCTCTTACCTCAAAATCAATTTGTAATTTGACCAGAATCTTAAATCCTTAATAAAT

CTTGTGTTTTGAAACTTCAA
Translation
 - UNI10568 -  - UNI19627 - MMGLGNGRRSMKSPPLILAALVACVIVLGFNYWIASSRSVELQ - UNI10593 - TRIVELEGRVRRAAA

ERGAVELKKNEFQGELQKQREQLDRIQSSHSFQLENVNKLHQDEK - UNI10509 - AVLVNNITTGEKLIRDLQD - UNI10609 - DQLKALQR

SYSSLQQDIFQFQKNQTSLEKKFSYDL - UNI10611 - LNQCISQMTEVKEQCDERIEEVIRKRNEAPGSRDLAETNNQHQQ - UNI13309 - A

LKPQPKLQEEVPSEEQMPQEKGDVPRNKSQIPAPNSESLGLKPQVQNE - UNI10274 - EETNEIQAVGEEHQQASIQGQAVADGTRVGAEKLDQHT

QLPAGLLARPEEDSQYPEREQLVIRDRQEQQRASEEG GGGQKNPGDEYDMDENEAESEREKQAALAGNDRNINV - UNI25223 - VLNADAQKRGI

INVPVGSERQSHILNQVGIHIPQQA

For any suggestions or comments, please send an email to unitrap@crg.es