Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000021559 (Dapk1)
Chromosomal location
Chr 13: 60703308 - 60864546 (+)
Description
death associated protein kinase 1 Gene [Source:MGI Symbol;Acc:MGI:1916885]
RefSeq_dna
NM_029653 NM_134062 
RefSeq_peptide
NP_083929.2 NP_598823.1 
UniGene
Mm.24103 
MGI
MGI:1916885 
Uniprot/SWISSPROT
Q80YE7 
Uniprot/SPTREMBL
Q3UKP8 
Human Ortholog
ENSG00000196730 (DAPK1)
Omim not available
UniTrap UNI33580
Vector Insertion
Chr 13: 60703958 - 60797591
Public Clones (sanger) IST10458C12 (tigm) IST14456G3 (tigm) IST14383C11 (tigm) IST11191H11 (tigm)
IST13430B2 (tigm) IST14871E8 (tigm) IST10491E8 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 1% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI9115
Vector Insertion
Chr 13: 60858899 - 60861995
Public Clones XK569 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 72% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000044083
Sequence
GCTGTCCCCACGTTGTCCGGAGGCGGAGGCAGGAGCCCGGGAACCGCAG AGGTCTGCGGCTTGGTGCATGAGGGGCTCGCAGCAGCGAGGCGGCGGTGG

GGATGGTTCGGGCCGCGGAGCCGGAGTGGCCTGGGCTTTGGTGAGGCGTGACAGTCTATCATGACTGTGTTCAGGCAGGAAAACGTGGACGACTACTACG

ACACCGGCGAGGAACTGGGCAG - UNI33580 - TGGACAGTTCGCAGTTGTGAAGAAATGTCGTGAGAAAAGTACCGGTCTTCAGTATGCGGCCAAG

TTCATCAAGAAAAGGAGGACCAAGTCCAGCCGGCGGGGCGTGAGCCGGGAGGACATCGAGCGGGAGGTCAGCATCCTGAAGGAGATCCGGCACCCAAATG

TCATCACCCTGCATGAGGTCTATGAGAACAAGACAGATGTCATTCTGATCCTGGAGCT TGTTGCAGGAGGTGAGCTGTTTGACTTCCTGGCTGAGAAGG

AATCTCTGACTGAAGAGGAGGCAACGGAATTCCTTAAGCAGATTCTCAGCGGCGTTTACTACCTGCACTCACTGCAGATCGCTCACTTTGACCTGAAG C

CGGAAAACATAATGCTTCTGGATAGAAATGTGCCCAAACCTCGGATCAAGATCATAGACTTTGGCTTGGCCCATAAAATTGACTTTGGAAATGAATTCAA

AAACATATTTGGGACACCAGAGTTTGTGG CTCCGGAGATAGTCAACTATGAGCCCCTGGGTCTTGAGGCAGATATGTG GAGCATCGGGGTAATAACCT

ATATCCT CCTAAGTGGGGCCTCCCCTTTTCTTGGAGACACCAAGCAAGAAACATTAGCGAATGTGTCCGCTGTCAACTACGACTTTGAGGAGGAATTCT

TCCGGAACACCAGTACCCTTGCCAAAGATTTCATCAGAAGACTGCTGGTCAAGGATCCAAA GAAGAGGATGACAATCCAGGACAGTTTGCAGCACCCCT

GGATCAAG CCTAAAGACACCCAACAAGCACTTAGTCGAAAAGCCTCAGCAGTAAACATGGAGAAATTCAAGAAGTTTGCAGCTCGGAAAAAATGGAAA 

CAATCTGTTCGCTTGATATCACTGTGCCAAAGATTATCCAGGTCATTTTTGTCCAGAAGTAACATGAGTGTCGCCAGGAGTGATGATACTCTG GATGAG

GAAGACTCCTTTGTGATGAAAGCCATCATCCATGCCATCAATGATGACAACGTACCCGGCCTGCAGCATCTCCTGGGCTCCTTGTCCAGCTATGACGTCA

ACCAGCCCAACAAG CATGGGACACCTCCATTACTGATTGCCGCAGGCTGTGGCAACATCCAGATGTTACAGTTACTCATAAAACGAGGCTCAAGGATTG

ACGTCCAGGATAAG GGAGGATCCAATGCCATCTACTGGGCCTCTCGGCATGGCCATGTGGATACTTTGAAATTTCTCAATGAGAACAAATGCCCTTTGG

ATGTTAAAGACAAG TCTGGAGAGACAGCTCTTCACGTGGCAGCCCGCTATGGCCATGCAGATGTGGTTCAACTACTGTGCAGTTTTGGCTCTAATCCTG

ATTTCCAGGACAAG GAAGAGGAAACCCCCCTGCACTGTGCTGCCTGGCATGGCTATTACTCCGTGGCTAAAGCTCTTTGTGAAGTTGGCTGCAACGTGA

ATATCAAGAATCGGGAGGGAGAGACCCCATTGCTGACGGCGTCTGCCAGGGGCTATCATGACATTGTGGAGTGTCTGGCTGAACATGGAGCTGACTTGAA

TGCTTCTGACAAG GATGGACACATCGCTCTTCATCTTGCTGTGAGGCGTTGTCAGATGGAAGTCATCAAGACCCTCCTTGGCCATGGGTCCTTTGTGGA

TTTCCAGGACAGGCATGGCAACACACCCCTGCACGTGGCCTGCAAAGATGGAAGCGCACCTATCGTGGTGGCCCTCTGTGAAGCCAGCTGCAATCTGGAC

ATCTCAAACAAG TATGGTCGGACTCCTCTCCACCTTGCAGCCAACAACGGGATCCTAGATGTGGTCCGCTACCTCTGTTTGATGGGCGCCAATGTGGAG

GCTCTAACCTCG GATGGAAAGACGGCCGAGGACCTCGCCAAGGCAGAACAGCACGAGCATGTGGCAGGGCTCCTGGCAAGACTGCGGAAG GACACACA

CCGAGGACTCTTCATCCAGCAACTCCGACCCACCCAGAATCTCCAGCCCAGAATCAAGCTCAAACTGTTTGGCCATTCGGGATCAGGGAAATCCACCCTG

GTGGAATCTCTCAAGTGTGGGCTGTTAAGGAGTTTCTTCAGAAGGCGCCGGCCCAGACTATCCTCTACCAACTCCACCCGCTTCCCACCGTCACCCCTGG

CTGCTAAGCCAACAG TCTCAGTGAGCATTAACAACCTGTACCCCGGCTGTGAGAACGTGAGCGTAAGGAGCCGCAGCATGATGTTCGAGCCGGGCCTCA

CCAAAGGGATGCTGGAAGTGTTCGTGGCTCCGTCTCACCACCTCCACTGCTCGACTGATGACCAGTCCACCAAAGCCATCGACATCCAGAATGCTTATTT

GAACG GAGTTGGTGATTTCAGTGTGTGGGAGTTCTCTGGAAACCCTGTGTACTTCTGTTGCTATGACTACTTTGCTGCCAACGACCCCACGTCCATCCA

CATCATCGTTTTCAGTCTCGAAGAACCCTATGAGATCCAGCTGAACCAAGTGATTTTCTGGCTCAGTTTCCTGAAGTCTCTGGTCCCAGTTGAAGAACCC

ATAG CATTTGGAGGCAAGCTGAAGAACCCTCTCCGAGTTGTCCTGGTGGCAACACATGCTGACATCATGAACATCCCTCGGCCTGCTGGAGGCGAGTTT

GGATATGACAAGGATACATCCTTGCTGAAAGAGATCAGAAACAG GTTCGGGAATGACCTTCATGTCTCAAACAAGCTGTTTGTCCTGGATGCAGGAGCG

TCTGGGTCTAAGGACATTAAGGTTCTTCGGAATCACCTGCAAGAAATACGGAGCCAGATTGTCTCG GGGTGTTCGCCCATGACTCACCTGTGCGAGAAG

ATCATCTCCACGCTGCCCTCCTGGCGGAAGCTCAACGGGCCAAACCAGCTGATGTCGCTGCAGCAGTTTGTGTATGACGTGCAGGACCAGCTGAACCCCC

TGGCCTCTGAGGATGACCTCAGGCGCATTGCACAACAGCTACACAGCACGGGCGAG - UNI9115 - ATAAACATCATGCAGAGTGAGACAGTGCAGG

ACGTGTTACTGCTGGATCCTCGATGGCTCTGCACCAACGTCCTGGGGAAGCTGCTGTCTGTGGAGACGCCCCGAGCCCTGCACCATTACCGGGGCCGCTA

CACCATGGAAGACATCCAGCGTCTGGTCCCAGACAGTGACGTGGAGGAGCTGCTGCAGATACTGGATGCCATGGACATCTGCGCCCGAGACCTGAGTAGT

GGGACTATGGTGGATATCCCTGCTCTGATCAAAACAGACAGCCTGCAGCGCTCCTGGGCGGATGAGGAGGATGAGGTGATGGTGTACGGTGGGGTGCGCA

TTGTCCCTGTAGAGCACCTCACCCCCTTCCCCTGTGGCATCTTTCACAAAGTTCAGGTCAACCTGTGCCGATGGATCCACCAGCAAAGCGCGGAGGGTGA

TGCGGACATCCGTCTGTGGGTGAGCGGCTGCAGGATCGCCAACCGCGGGGCTGAGTTGCTGGTGCTGCTGGTCAATCACGGTCAGGGCATCGAGGTACAG

GTGCGTGGCCTGGAGACGGAGAAGATTAAGTGCTGCCTGCTGCTGGACTCGGTGTGCAGCACCATCGAGACCGTCATGGCCACCACCTTGCCAGGGTTGT

TGACGGTGAAGCACTACCTGAGCCCCCAGCAGCTAAGGGAGCACCACGAACCGGTCATGGTCTATCAGCCCCGGGACTTCTTCCGTGCGCAGACCCTGAA

AGAGAGTTCCCTTACCAACACCATGGGTGGGTACAAGGAGAGCTTCAGCAGCATCACGTGCTTTGGGTGTCATGACGTCTACTCACAGGCCAGTCTTGGC

ATGGATATCCATGCGTCAGACCTGAGTCTCCTGACCCGGAGGAAACTGAGTCGCCTGCTTGACCCACCCGACCCCATGGGGAAGGACTGGTGCCTTCTGG

CCATGAACTTGGGCCTCCCAGACATGGTGGCCAAACACAACGTCAACAACAGGGCTTCTAGGGATTTCCTCCCTAGCCCAGTGCATGCCTTGCTACAGGA

ATGGACCTCCTACCCTGAGAGCACGGTGGGCATCCTTATATCCAAACTTCGGGAGCTGGGGCGCCGGGATGCTGCGGACTTTTTACTGAAGGCCTCCTCT

GTGTTCAAGATCAACCTTGATGGCAATGGCCAGGAGGCCTATGCCTCAAGCTGTAACAGTGGCACGTCCTACAATTCCATTAGCTCAGTGGTGTCCCGGT

GAGGGCAGCCTTGGCTTGG GAGAGACTCCCATGCTTGGACCCCACTGTATGATTTATAAACAGACAATATGTGAGTGCCTTTTGCAGAAGAGGGTGTGT

TGAATCATCTGAGTCAGACCGGAGCTGCCACCAAGGAAACGCTACCTCTCTGTCCCTTGCTGTGTGCTGATCATCGCCAGAGGTGCTTCACTCTGACTTG

TTGGTTTTGGATTTTTTTCTTTCTTTCTTTCTTTTTCTAGGGAGGGGGCTCTGTGTTTCATTTGGCAAGGAAAGAGGAGAAAGGAGTCCTCCCCAGAGTG

TTCATGGCCAGTGTTGCTGTAAGAAGACAATTTTGGTTGCTTTTGTCAAAAGATCCGTGTGAACACGCACATGAGACCTACAGACGGTCACGCTCCCTCA

CTCCCTCCCTTCTCAGGTAGAAGGTTGACATAGTGTAGGGCTACAGAGACCTGTGTTAAGAATTCCGAAGACCCCCCCCCCCCCATGTGTAACCCATGCC

AGTCCGTTATTGTTGGTGCATAGCAGGTTGGTTCTACGCTGAGATCCTGGTTTGGTCACTTCCCATACTTGAAGTCAGAGAGAAAGGAAATAGAGGGAAC

GAGTTTTTCTTGGGGGTGACCAAGATTGTGATTGAATTCTAAATCAGTGTGAGGGAAAGTGTTTTAATTCTTCTGTCCTGAGAAGCATGTCATGTTACCA

TATCATCTGTACATATATATATGCACTATGTATATACATATATATTGATACTGGTATTTTTACTTAATCTATAAGATGTCGTAAAATAATTAAGTTTGGG

TTTTTTTTTCTCTCTTCTTTGGTTTTATAAATAAACGGTTGCTTATTGC
Translation
 MTVFRQENVDDYYDTGEELGS - UNI33580 - SGQFAVVKKCREKSTGLQYAAKFIKKRRTKSSRRGVSREDIEREVSILKEIRHPNVITLHEVYE

NKTDVILILEL LVAGGELFDFLAEKESLTEEEATEFLKQILSGVYYLHSLQIAHFDLK PENIMLLDRNVPKPRIKIIDFGLAHKIDFGNEFKNIFGTP

EFVA APEIVNYEPLGLEADMW WSIGVITYIL LLSGASPFLGDTKQETLANVSAVNYDFEEEFFRNTSTLAKDFIRRLLVKDPK KKRMTIQDSLQHP

WIK PKDTQQALSRKASAVNMEKFKKFAARKKWK QSVRLISLCQRLSRSFLSRSNMSVARSDDTL DEEDSFVMKAIIHAINDDNVPGLQHLLGSLSSY

DVNQPNK HGTPPLLIAAGCGNIQMLQLLIKRGSRIDVQDK GGSNAIYWASRHGHVDTLKFLNENKCPLDVKDK SGETALHVAARYGHADVVQLLCSF

GSNPDFQDK EEETPLHCAAWHGYYSVAKALCEVGCNVNIKNREGETPLLTASARGYHDIVECLAEHGADLNASDK DGHIALHLAVRRCQMEVIKTLLG

HGSFVDFQDRHGNTPLHVACKDGSAPIVVALCEASCNLDISNK YGRTPLHLAANNGILDVVRYLCLMGANVEALTS DGKTAEDLAKAEQHEHVAGLLA

RLRK DTHRGLFIQQLRPTQNLQPRIKLKLFGHSGSGKSTLVESLKCGLLRSFFRRRRPRLSSTNSTRFPPSPLAAKPTV VSVSINNLYPGCENVSVRS

RSMMFEPGLTKGMLEVFVAPSHHLHCSTDDQSTKAIDIQNAYLNG GVGDFSVWEFSGNPVYFCCYDYFAANDPTSIHIIVFSLEEPYEIQLNQVIFWLS

FLKSLVPVEEPIA AFGGKLKNPLRVVLVATHADIMNIPRPAGGEFGYDKDTSLLKEIRNR RFGNDLHVSNKLFVLDAGASGSKDIKVLRNHLQEIRSQ

IVS GCSPMTHLCEKIISTLPSWRKLNGPNQLMSLQQFVYDVQDQLNPLASEDDLRRIAQQLHSTGE - UNI9115 - INIMQSETVQDVLLLDPRWL

CTNVLGKLLSVETPRALHHYRGRYTMEDIQRLVPDSDVEELLQILDAMDICARDLSSGTMVDIPALIKTDSLQRSWADEEDEVMVYGGVRIVPVEHLTPF

PCGIFHKVQVNLCRWIHQQSAEGDADIRLWVSGCRIANRGAELLVLLVNHGQGIEVQVRGLETEKIKCCLLLDSVCSTIETVMATTLPGLLTVKHYLSPQ

QLREHHEPVMVYQPRDFFRAQTLKESSLTNTMGGYKESFSSITCFGCHDVYSQASLGMDIHASDLSLLTRRKLSRLLDPPDPMGKDWCLLAMNLGLPDMV

AKHNVNNRASRDFLPSPVHALLQEWTSYPESTVGILISKLRELGRRDAADFLLKASSVFKINLDGNGQEAYASSCNSGTSYNSISSVVSR 
Transcript ENSMUST00000077453
Sequence
GGAGCCGCGAGCGCAGCGGAGGAGGAGGGCGCGGAGGAGGTGGTGGCTGCGTCCCCGCGGGGCCGAGCTGCGCCCGACGCAAGGAGCGGAGGCCGCTCGG

AGCTGCCGGGGACCTGGACCCGCCGCGGGGCTCAGGGCGCACGAAGCGACAGCTGCGGGACCGG AGGTCTGCGGCTTGGTGCATGAGGGGCTCGCAGCA

GCGAGGCGGCGGTGGGGATGGTTCGGGCCGCGGAGCCGGAGTGGCCTGGGCTTTGGTGAGGCGTGACAGTCTATCATGACTGTGTTCAGGCAGGAAAACG

TGGACGACTACTACGACACCGGCGAGGAACTGGGCAG - UNI33580 - TGGACAGTTCGCAGTTGTGAAGAAATGTCGTGAGAAAAGTACCGGTCTT

CAGTATGCGGCCAAGTTCATCAAGAAAAGGAGGACCAAGTCCAGCCGGCGGGGCGTGAGCCGGGAGGACATCGAGCGGGAGGTCAGCATCCTGAAGGAGA

TCCGGCACCCAAATGTCATCACCCTGCATGAGGTCTATGAGAACAAGACAGATGTCATTCTGATCCTGGAGCT TGTTGCAGGAGGTGAGCTGTTTGACT

TCCTGGCTGAGAAGGAATCTCTGACTGAAGAGGAGGCAACGGAATTCCTTAAGCAGATTCTCAGCGGCGTTTACTACCTGCACTCACTGCAGATCGCTCA

CTTTGACCTGAAG CCGGAAAACATAATGCTTCTGGATAGAAATGTGCCCAAACCTCGGATCAAGATCATAGACTTTGGCTTGGCCCATAAAATTGACTT

TGGAAATGAATTCAAAAACATATTTGGGACACCAGAGTTTGTGG CTCCGGAGATAGTCAACTATGAGCCCCTGGGTCTTGAGGCAGATATGTG GAGCA

TCGGGGTAATAACCTATATCCT CCTAAGTGGGGCCTCCCCTTTTCTTGGAGACACCAAGCAAGAAACATTAGCGAATGTGTCCGCTGTCAACTACGACT

TTGAGGAGGAATTCTTCCGGAACACCAGTACCCTTGCCAAAGATTTCATCAGAAGACTGCTGGTCAAGGATCCAAA GAAGAGGATGACAATCCAGGACA

GTTTGCAGCACCCCTGGATCAAG CCTAAAGACACCCAACAAGCACTTAGTCGAAAAGCCTCAGCAGTAAACATGGAGAAATTCAAGAAGTTTGCAGCTC

GGAAAAAATGGAAA CAATCTGTTCGCTTGATATCACTGTGCCAAAGATTATCCAGGTCATTTTTGTCCAGAAGTAACATGAGTGTCGCCAGGAGTGATG

ATACTCTG GATGAGGAAGACTCCTTTGTGATGAAAGCCATCATCCATGCCATCAATGATGACAACGTACCCGGCCTGCAGCATCTCCTGGGCTCCTTGT

CCAGCTATGACGTCAACCAGCCCAACAAG CATGGGACACCTCCATTACTGATTGCCGCAGGCTGTGGCAACATCCAGATGTTACAGTTACTCATAAAAC

GAGGCTCAAGGATTGACGTCCAGGATAAG GGAGGATCCAATGCCATCTACTGGGCCTCTCGGCATGGCCATGTGGATACTTTGAAATTTCTCAATGAGA

ACAAATGCCCTTTGGATGTTAAAGACAAG TCTGGAGAGACAGCTCTTCACGTGGCAGCCCGCTATGGCCATGCAGATGTGGTTCAACTACTGTGCAGTT

TTGGCTCTAATCCTGATTTCCAGGACAAG GAAGAGGAAACCCCCCTGCACTGTGCTGCCTGGCATGGCTATTACTCCGTGGCTAAAGCTCTTTGTGAAG

TTGGCTGCAACGTGAATATCAAGAATCGGGAGGGAGAGACCCCATTGCTGACGGCGTCTGCCAGGGGCTATCATGACATTGTGGAGTGTCTGGCTGAACA

TGGAGCTGACTTGAATGCTTCTGACAAG GATGGACACATCGCTCTTCATCTTGCTGTGAGGCGTTGTCAGATGGAAGTCATCAAGACCCTCCTTGGCCA

TGGGTCCTTTGTGGATTTCCAGGACAGGCATGGCAACACACCCCTGCACGTGGCCTGCAAAGATGGAAGCGCACCTATCGTGGTGGCCCTCTGTGAAGCC

AGCTGCAATCTGGACATCTCAAACAAG TATGGTCGGACTCCTCTCCACCTTGCAGCCAACAACGGGATCCTAGATGTGGTCCGCTACCTCTGTTTGATG

GGCGCCAATGTGGAGGCTCTAACCTCG GATGGAAAGACGGCCGAGGACCTCGCCAAGGCAGAACAGCACGAGCATGTGGCAGGGCTCCTGGCAAGACTG

CGGAAG GACACACACCGAGGACTCTTCATCCAGCAACTCCGACCCACCCAGAATCTCCAGCCCAGAATCAAGCTCAAACTGTTTGGCCATTCGGGATCA

GGGAAATCCACCCTGGTGGAATCTCTCAAGTGTGGGCTGTTAAGGAGTTTCTTCAGAAGGCGCCGGCCCAGACTATCCTCTACCAACTCCACCCGCTTCC

CACCGTCACCCCTGGCTGCTAAGCCAACAG TCTCAGTGAGCATTAACAACCTGTACCCCGGCTGTGAGAACGTGAGCGTAAGGAGCCGCAGCATGATGT

TCGAGCCGGGCCTCACCAAAGGGATGCTGGAAGTGTTCGTGGCTCCGTCTCACCACCTCCACTGCTCGACTGATGACCAGTCCACCAAAGCCATCGACAT

CCAGAATGCTTATTTGAACG GAGTTGGTGATTTCAGTGTGTGGGAGTTCTCTGGAAACCCTGTGTACTTCTGTTGCTATGACTACTTTGCTGCCAACGA

CCCCACGTCCATCCACATCATCGTTTTCAGTCTCGAAGAACCCTATGAGATCCAGCTGAACCAAGTGATTTTCTGGCTCAGTTTCCTGAAGTCTCTGGTC

CCAGTTGAAGAACCCATAG CATTTGGAGGCAAGCTGAAGAACCCTCTCCGAGTTGTCCTGGTGGCAACACATGCTGACATCATGAACATCCCTCGGCCT

GCTGGAGGCGAGTTTGGATATGACAAGGATACATCCTTGCTGAAAGAGATCAGAAACAG GTTCGGGAATGACCTTCATGTCTCAAACAAGCTGTTTGTC

CTGGATGCAGGAGCGTCTGGGTCTAAGGACATTAAGGTTCTTCGGAATCACCTGCAAGAAATACGGAGCCAGATTGTCTCG GGGTGTTCGCCCATGACT

CACCTGTGCGAGAAGATCATCTCCACGCTGCCCTCCTGGCGGAAGCTCAACGGGCCAAACCAGCTGATGTCGCTGCAGCAGTTTGTGTATGACGTGCAGG

ACCAGCTGAACCCCCTGGCCTCTGAGGATGACCTCAGGCGCATTGCACAACAGCTACACAGCACGGGCGAG - UNI9115 - ATAAACATCATGCAGA

GTGAGACAGTGCAGGACGTGTTACTGCTGGATCCTCGATGGCTCTGCACCAACGTCCTGGGGAAGCTGCTGTCTGTGGAGACGCCCCGAGCCCTGCACCA

TTACCGGGGCCGCTACACCATGGAAGACATCCAGCGTCTGGTCCCAGACAGTGACGTGGAGGAGCTGCTGCAGATACTGGATGCCATGGACATCTGCGCC

CGAGACCTGAGTAGTGGGACTATGGTGGATATCCCTGCTCTGATCAAAACAGACAGCCTGCAGCGCTCCTGGGCGGATGAGGAGGATGAGGTGATGGTGT

ACGGTGGGGTGCGCATTGTCCCTGTAGAGCACCTCACCCCCTTCCCCTGTGGCATCTTTCACAAAGTTCAGGTCAACCTGTGCCGATGGATCCACCAGCA

AAGCGCGGAGGGTGATGCGGACATCCGTCTGTGGGTGAGCGGCTGCAGGATCGCCAACCGCGGGGCTGAGTTGCTGGTGCTGCTGGTCAATCACGGTCAG

GGCATCGAGGTACAGGTGCGTGGCCTGGAGACGGAGAAGATTAAGTGCTGCCTGCTGCTGGACTCGGTGTGCAGCACCATCGAGACCGTCATGGCCACCA

CCTTGCCAGGGTTGTTGACGGTGAAGCACTACCTGAGCCCCCAGCAGCTAAGGGAGCACCACGAACCGGTCATGGTCTATCAGCCCCGGGACTTCTTCCG

TGCGCAGACCCTGAAAGAGAGTTCCCTTACCAACACCATGGGTGGGTACAAGGAGAGCTTCAGCAGCATCACGTGCTTTGGGTGTCATGACGTCTACTCA

CAGGCCAGTCTTGGCATGGATATCCATGCGTCAGACCTGAGTCTCCTGACCCGGAGGAAACTGAGTCGCCTGCTTGACCCACCCGACCCCATGGGGAAGG

ACTGGTGCCTTCTGGCCATGAACTTGGGCCTCCCAGACATGGTGGCCAAACACAACGTCAACAACAGGGCTTCTAGGGATTTCCTCCCTAGCCCAGTGCA

TGCCTTGCTACAGGAATGGACCTCCTACCCTGAGAGCACGGTGGGCATCCTTATATCCAAACTTCGGGAGCTGGGGCGCCGGGATGCTGCGGACTTTTTA

CTGAAGGCCTCCTCTGTGTTCAAGATCAACCTTGATGGCAATGGCCAGGAGGCCTATGCCTCAAGCTGTAACAGTGGCACGTCCTACAATTCCATTAGCT

CAGTGGTGTCCCGGTGAGGGCAGCCTTGGCTTGGGTAGGGTCTTTATGGACTGAGATGCAAGGGCGGAGGGGAGGGGAGGGGGCAGTGCACCCTTCTCAG

GGCAGATTCCCACACATTCTTTATGCTCCTGAAGACACCCTCCACCCCGTCCTCTGCTTCCCAATCTCCATCTCCCTCCCTGTCACACATCCCCCAGTCA

AGAGCAGACCGTATCCTTCACTTTGGTCATTTGGGATGCTAGAGCCCTTCCTGTCAGTGTTTTGGACTCCATCTCTTGTCCTCTAATACCTTGCTTATTA

CTGATAATTTTATTGAGATTCCAAACTTTTCGATGAAAACAATTTAACTCCTTTATTGATTATCCTTATCAAAAAAGAAAAAAAAAAAAGAAAAAGAAAG

GAAGAAATAAGGAAAGAAAGAAAGACACACATTTATCCATAATGTGTATTTCTTATCCTTTTCTCTGCTGTACCAGCCCCTCAGCTTATCTCTTTTATAT

TTGTAGGAGAGACTCCCATGCTTGGACCCCACTGTATGATTTATAAACAGACAATATGTGAGTGCCTTTTGCAGAAGAGGGTGTGTTGAATCATCTGAGT

CAGACCGGAGCTGCCACCAAGGAAACGCTACCTCTCTGTCCCTTGCTGTGTGCTGATCATCGCCAGAGGTGCTTCACTCTGACTTGTTGGTTTTGGATTT

TTTTCTTTCTTTCTTTCTTTTTCTAGGGAGGGGGCTCTGTGTTTCATTTGGCAAGGAAAGAGGAGAAAGGAGTCCTCCCCAGAGTGTTCATGGCCAGTGT

TGCTGTAAGAAGACAATTTTGGTTGCTTTTGTCAAAAGATCCGTGTGAACACGCACATGAGACCTACAGACGGTCACGCTCCCTCACTCCCTCCCTTCTC

AGGTAGAAGGTTGACATAGTGTAGGGCTACAGAGACCTGTGTTAAGAATTCCGAAGACCCCCCCCCCCCCATGTGTAACCCATGCCAGTCCGTTATTGTT

GGTGCATAGCAGGTTGGTTCTACGCTGAGATCCTGGTTTGGTCACTTCCCATACTTGAAGTCAGAGAGAAAGGAAATAGAGGGAACGAGTTTTTCTTGGG

GGTGACCAAGATTGTGATTGAATTCTAAATCAGTGTGAGGGAAAGTGTTTTAATTCTTCTGTCCTGAGAAGCATGTCATGTTACCATATCATCTGTACAT

ATATATATGCACTATGTATATACATATATATTGATACTGGTATTTTTACTTAATCTATAAGATGTCGTAAAATAATTAAGTTTGGGTTTTTTTTTCTCTC

TTCTTTGGTTTTATAAATAAACGGTTGCTTATTGC
Translation
 MTVFRQENVDDYYDTGEELGS - UNI33580 - SGQFAVVKKCREKSTGLQYAAKFIKKRRTKSSRRGVSREDIEREVSILKEIRHPNVITLHEVYE

NKTDVILILEL LVAGGELFDFLAEKESLTEEEATEFLKQILSGVYYLHSLQIAHFDLK PENIMLLDRNVPKPRIKIIDFGLAHKIDFGNEFKNIFGTP

EFVA APEIVNYEPLGLEADMW WSIGVITYIL LLSGASPFLGDTKQETLANVSAVNYDFEEEFFRNTSTLAKDFIRRLLVKDPK KKRMTIQDSLQHP

WIK PKDTQQALSRKASAVNMEKFKKFAARKKWK QSVRLISLCQRLSRSFLSRSNMSVARSDDTL DEEDSFVMKAIIHAINDDNVPGLQHLLGSLSSY

DVNQPNK HGTPPLLIAAGCGNIQMLQLLIKRGSRIDVQDK GGSNAIYWASRHGHVDTLKFLNENKCPLDVKDK SGETALHVAARYGHADVVQLLCSF

GSNPDFQDK EEETPLHCAAWHGYYSVAKALCEVGCNVNIKNREGETPLLTASARGYHDIVECLAEHGADLNASDK DGHIALHLAVRRCQMEVIKTLLG

HGSFVDFQDRHGNTPLHVACKDGSAPIVVALCEASCNLDISNK YGRTPLHLAANNGILDVVRYLCLMGANVEALTS DGKTAEDLAKAEQHEHVAGLLA

RLRK DTHRGLFIQQLRPTQNLQPRIKLKLFGHSGSGKSTLVESLKCGLLRSFFRRRRPRLSSTNSTRFPPSPLAAKPTV VSVSINNLYPGCENVSVRS

RSMMFEPGLTKGMLEVFVAPSHHLHCSTDDQSTKAIDIQNAYLNG GVGDFSVWEFSGNPVYFCCYDYFAANDPTSIHIIVFSLEEPYEIQLNQVIFWLS

FLKSLVPVEEPIA AFGGKLKNPLRVVLVATHADIMNIPRPAGGEFGYDKDTSLLKEIRNR RFGNDLHVSNKLFVLDAGASGSKDIKVLRNHLQEIRSQ

IVS GCSPMTHLCEKIISTLPSWRKLNGPNQLMSLQQFVYDVQDQLNPLASEDDLRRIAQQLHSTGE - UNI9115 - INIMQSETVQDVLLLDPRWL

CTNVLGKLLSVETPRALHHYRGRYTMEDIQRLVPDSDVEELLQILDAMDICARDLSSGTMVDIPALIKTDSLQRSWADEEDEVMVYGGVRIVPVEHLTPF

PCGIFHKVQVNLCRWIHQQSAEGDADIRLWVSGCRIANRGAELLVLLVNHGQGIEVQVRGLETEKIKCCLLLDSVCSTIETVMATTLPGLLTVKHYLSPQ

QLREHHEPVMVYQPRDFFRAQTLKESSLTNTMGGYKESFSSITCFGCHDVYSQASLGMDIHASDLSLLTRRKLSRLLDPPDPMGKDWCLLAMNLGLPDMV

AKHNVNNRASRDFLPSPVHALLQEWTSYPESTVGILISKLRELGRRDAADFLLKASSVFKINLDGNGQEAYASSCNSGTSYNSISSVVSR

For any suggestions or comments, please send an email to unitrap@crg.es