Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000021594 (Srd5a1)
Chromosomal location
Chr 13: 69712328 - 69750319 (-)
Description
steroid 5 alpha-reductase 1 Gene [Source:MGI Symbol;Acc:MGI:98400]
Human Ortholog
not available
Omim not available
UniTrap UNI37285
Vector Insertion
Chr 13: 69714075 - 69725462
Public Clones (ggtc) CMHD-GT_491B5-3 (cmhd)
Private Clones not available
Severity of mutation (?) Insertion after 92% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000059235
Sequence
CGGGCGGGAGGGTATCTTCTGGTGGTGCTAGCCTGTGCTCCTGTCTCCGCCCGAGCAGGTGGCTCGCCCCTCCCCTGGGCAGGTACACCCTGCTGGAGCG

CTGGCCCTTGTGGGCTGCTCTGCGCCCTCCTCCTGAGCTTATATGTGGCTCCACTTGGACATCCGAGCATGGAGCACGCTGCTCGACCTCAGCTATGGAG

TTGGATGAGTTGCGCCTACTGGATGCGCTAGTCTACCTGGAGGGTTTCCTGGCTTTCGTGGCCTTCGTGGGGCTCCAGATGGTGGGCTCTTCCTACGGCC

GCTACTCCTCGCAGTGGTCCGGCCGCCGAGTGCCCGCGCGACCTGCCTGGTTCCTACAGGAGCTGCCTTCAATGGCCTGGCCGCTGTACGAGTGCATCCG

TCCTGCAGCCGCCCGACTGGGCAACCTGCCTAACCGCGTCCTGCTAGCTATGTTTCTGATCCACTACGTGCAAAG GACGCTGGTTTTTCCAGTTCTGAT

CAGGGGAGGGAAGCCCACCCTGCTGTTCACCTTTGTCTTGGCCTTCCTGTTCTGCACCTTAAATGGCTACTTGCAGAGCCGATACTTGAGCCAGTTTGCG

GTGTATGCTGAAGACTGGGTAACCCATCCCTGTTTCCTGACAG GCTTTGCCCTGTGGTTAGTGGGCATGGTGATAAATATCCACTCAGACCACATCCTG

CGGAATCTGAGAAAACCAGGGGAAACTGGATACAAAATACCCAGGG CTCTGCAAATTCACAGCCTCACCGGGCAGCATTTCCTACTGACTGAAAGTTTA

CATCGTGAACCACAGTTAGATCTGGCTTTTTGGAAGATGATTAAGGGGTGA
Translation
MELDELRLLDALVYLEGFLAFVAFVGLQMVGSSYGRYSSQWSGRRVPARPAWFLQELPSMAWPLYECIRPAAARLGNLPNRVLLAMFLIHYVQR RTLVF

PVLIRGGKPTLLFTFVLAFLFCTLNGYLQSRYLSQFAVYAEDWVTHPCFLTG GFALWLVGMVINIHSDHILRNLRKPGETGYKIPRA ALQIHSLTGQH

FLLTESLHREPQLDLAFWKMIKG
Transcript ENSMUST00000091514
Sequence
CGGGCGGGAGGGTATCTTCTGGTGGTGCTAGCCTGTGCTCCTGTCTCCGCCCGAGCAGGTGGCTCGCCCCTCCCCTGGGCAGGTACACCCTGCTGGAGCG

CTGGCCCTTGTGGGCTGCTCTGCGCCCTCCTCCTGAGCTTATATGTGGCTCCACTTGGACATCCGAGCATGGAGCACGCTGCTCGACCTCAGCTATGGAG

TTGGATGAGTTGCGCCTACTGGATGCGCTAGTCTACCTGGAGGGTTTCCTGGCTTTCGTGGCCTTCGTGGGGCTCCAGATGGTGGGCTCTTCCTACGGCC

GCTACTCCTCGCAGTGGTCCGGCCGCCGAGTGCCCGCGCGACCTGCCTGGTTCCTACAGGAGCTGCCTTCAATGGCCTGGCCGCTGTACGAGTGCATCCG

TCCTGCAGCCGCCCGACTGGGCAACCTGCCTAACCGCGTCCTGCTAGCTATGTTTCTGATCCACTACGTGCAAAG GACGCTGGTTTTTCCAGTTCTGAT

CAGGGGAGGGAAGCCCACCCTGCTGTTCACCTTTGTCTTGGCCTTCCTGTTCTGCACCTTAAATGGCTACTTGCAGAGCCGATACTTGAGCCAGTTTGCG

GTGTATGCTGAAGACTGGGTAACCCATCCCTGTTTCCTGACAG GCTTTGCCCTGTGGTTAGTGGGCATGGTGATAAATATCCACTCAGACCACATCCTG

CGGAATCTGAGAAAACCAGGGGAAACTGGATACAAAATACCCAGGG GAGGCCTGTTTGAATATGTATCTTCAGCCAACTATTTTGGGGAGCTCGTGGAG

TGGTGTGGCTTTGCACTGGCCAGCTGGTCCCTCCAGGGCGTGGTGTTTGCTCTGTTCACCCTGTGTGCACTGTTCACCAGAGCGAGGCAGCATCATCA -

 UNI37285 - GTGGTACCTCGAGAAGTTTGAAGATTACCCCAAAACAAGAAAAATACTAATTCCATTCCTGCTTTAGTGTGCTGTCCATGCTGTTGTC

TTCCATAAGCTGAGTGTCTGTCTTCCCGGTGGCTTTGCTCTGAGCACATACAAGTGAATTGTTTTCCTTATTTCTCCTGCAGTTCCATAGTTCTCAGGAA

GGGCAATGGGAGGGTGTTGTCCCCTGGTAAAGGACAAAGCCAAACAAAAACTAATCCACCATGTACAGTTAGGGGCTACAGTGCCTAGTAGGTCAGAAGC

AGGGAGCAATGAGTCATGGTGCCTCTGGCTTCTGGTACCCCTTACAACAAGAATTCCACCCAGGCCAGCAGCAGTCACGTTCCTCCTTCACAGATACATG

TTCTGCCTGCTCAGCCCTTGCCACAGAGGCCTGGAGCTGTGGGAGTGTGGCCCAGGGGCAACCTGCCATCCTTGACTGCAGACCCCTTTGACCCCCAGAC

ACTGGTAAGAGAAGTGTTCCTACAACATGTCCTGTCCCTCAGAGGTGAGACTGCACAGTATCCATTCACTCCCTGAGCCCAATTTTGCTCTTCCTTTGGG

CTAGAATTCATTAAAGTCCTTCAAAAATAAATAAATAAATAAAAACACTCTTAATATTATAAAACAAAATGTCAAAACAGGATTTCCTATTTTGAATGCA

CCCCAAGGACCAATCATGGCACATGAAGATGGAAAGCTCAGGGCTATCCTGGGCTTTGTAGGGAGACCCTCTTTGGGGGAAAAATGATAACAACCGGCTA

ACAATCCAAGGAATTGATGGCAGTAATAAAAGGTGCCACCCACACAAGTACTAGCTTGGTTGGGAGAAAGATGTTCACCCAGGATACTAACCCCACTGTG

GCCCTGGGCAGTCTGAGGACCACTGGTGAAGAGCCATCCTCACTGGATGGATTAGCACTGCCCCGGGGCAGCAGCTGCACGTACCACTCACCCTTCGCCA

TCAGATGCCACCACGAGAGGAAACAGGACAGGACTGTGTGCTCTGATCCCAGTAAAGATGCTGCAGGAAGACTGGCAGGCACACCTAACGGTGTGCATAG

TGCCCACCACCTGCCTTTCCTGCACGTACCACCTGCTGGTTCTTGCCCCCCACCTCCGTGTGCCCACGGCCACCTTCCCTTGGCTTCCCAGCAGGGCTTC

CTCAGCTCTTTTGCTCTCAGACAGAAACAATTCTCTGTGCCTCTGATTCACAGAATGTCTAGGCTTGACCCAGGAAACTTCATGATGCGGCTACTTCATT

TTAACAAAGAACAATCCTTTACCCTCCCCTTTTCTGACCAAGGAACTATTTGAAAACCTAAAGCACTAAATATTGTAGCTCTTCTCTCAAAACCTTAGTG

AGGCCTACCTGGTGTGTCCTGAAAGGTTTGTGTGGGAGGATGTACACAGCTGAGACTCTGGGGTTGTTTGCTGTGAATTTGACCTCTTTTGGAGGGCATG

GTGCTAAAGTTGGAACCCAGGACTTCAGGTTGCTAGGCAGATGTCCTGACACTAAGCCACATCACATATTAGCCCTGTGATGCCTCTTTGTTTATGAAGG

ACCAAACTGCCCACAGGCTTGTAGTTGCTCCCCGTGCTAAGTGAGAGATTAAGAGGAATCTTGTCTTAACACTATACTCTACTTCATTCCCTGAAACTCG

TTATTTACTTGTGTGAACCACGCTTATTAAGGAAATAATAAAACTACAGTTATAAGTCC
Translation
MELDELRLLDALVYLEGFLAFVAFVGLQMVGSSYGRYSSQWSGRRVPARPAWFLQELPSMAWPLYECIRPAAARLGNLPNRVLLAMFLIHYVQR RTLVF

PVLIRGGKPTLLFTFVLAFLFCTLNGYLQSRYLSQFAVYAEDWVTHPCFLTG GFALWLVGMVINIHSDHILRNLRKPGETGYKIPRG GGLFEYVSSAN

YFGELVEWCGFALASWSLQGVVFALFTLCALFTRARQHHQ - UNI37285 - QWYLEKFEDYPKTRKILIPFLL

For any suggestions or comments, please send an email to unitrap@crg.es