Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000021595 (Nsun2)
Chromosomal location
Chr 13: 69750941 - 69774535 (+)
Description
NOL1/NOP2/Sun domain family member 2 Gene [Source:MGI (curated);Acc:Nsun2-002]
RefSeq_dna
NM_145354 
RefSeq_peptide
NP_663329.2 
UniGene
Mm.260009 Mm.395981 
MGI
MGI:107252 
Uniprot/SWISSPROT
Q1HFZ0 
Human Ortholog
ENSG00000037474 (NSUN2)
Omim not available
UniTrap UNI29608
Vector Insertion
Chr 13: 69751337 - 69751815
Public Clones E139D02 (ggtc)
Private Clones not available
Severity of mutation (?) Insertion after 3% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI12867
Vector Insertion
Chr 13: 69751921 - 69754289
Public Clones CMHD-GT_372H5-3 (cmhd) Ayu21-B114 (egtc)
Private Clones not available
Severity of mutation (?) Insertion after 8% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI37617
Vector Insertion
Chr 13: 69754396 - 69756283
Public Clones (cmhd)
Private Clones not available
Severity of mutation (?) Insertion after 13% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI37337
Vector Insertion
Chr 13: 69756356 - 69756983
Public Clones CMHD-GT_452A5-3 (cmhd)
Private Clones not available
Severity of mutation (?) Insertion after 16% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI10691
Vector Insertion
Chr 13: 69758517 - 69760482
Public Clones D014D11 (ggtc) Q021B08 (ggtc) F046F01 (ggtc)
Private Clones not available
Severity of mutation (?) Insertion after 30% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI29945
Vector Insertion
Chr 13: 69760558 - 69762040
Public Clones (sanger) D184B03 (ggtc) D014D11 (ggtc)
Private Clones not available
Severity of mutation (?) Insertion after 33% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000022087
Sequence
GTGGGCCGGGTTCGCGGGTGTCGGTCGGAGCTTGCTCACCTGTCGCTTTCCTGGCAGGGCTGGGAAGGTGGCTATCCCGAGATCGTAAAGGAGAACAAGC

TCTTCGAGCACTACTATCAGGAACTCAAGATCGTGCCAGAGGGAGAATGGGACCAATTCATGGAGTCACTCCGAGAACCTCTCCCAGCCACACTGAGAAT

CACTGGGTACAAAAG - UNI29608 - CCATGCCAAAGAGATTCTCCATTGCTTGAAGAACAAGTACTTTAAGGAGTTGGAGGACCTGGAAGTAGATG

GACAGAAAGTTGAAGTTCCACAACCACTAAGCTG - UNI12867 - GTACCCTGAAGAACTTGCCTGGCATACAAACTTAAGTCGGAAAATCTTGAGG

AAGTCCCCGTTGTTGGCAAAGTTCCATCAGTTCCTGGTCAGCGAGACTGAGTCT GGAAACATCAGCCGCCAGGAGGCTGTCAGCATGATCCCCCCACTG

CTGCTCAACGTGGAGCCACACCATAAG ATCTTAGACATGTGTGCAGCCCCTGGATCCAAGACCACACAGTTAATTGAAATGTTGCATGCAGACATGAGT

GTGCCCTTTCCAG AGGGATTTGTAATCGCAAATGACGTGGACAACAAGCGCTGCTATCTGCTCGTCCATCAGGCCAAAAGGTTGAGCAGTCCCTGCATC

ATGGTGGTAAACCATGACGCATCCAGCATACCTAGACTTACAGTAGATGTGGACGGAAGGAAAGAGATTCTCTTCTATGATCGAATTTTATGTGATGTCC

CTTGCAG - UNI10691 - TGGCGATGGCACAATGAGAAAAAACATTGATGTCTGGAAGAAATGGACAACCTTAAACAGCTTGCAGCTCCATGG - U

NI29945 - CCTGCAGCTTCGGATTGCAACTCGAGGTGCTGAGCAGCTGGCGGAAGGTGGCAGGATGGTGTATTCCACGTGTTCCTTGAACCCCGTGGA

GGATGAAGCAGTGATCGCAGCTCTGCTAGAGAAGAGTGAAG GAGCTCTTGAGCTTGCTGATGTGTCTGCTGAGTTGCCAGGACTGAAGTGGATGCCTGG

AGTCTCACAGTGGAAG GTCATGACTAGAGACGGGCAGTGGTTTGCAGACTGGCATGAGGTTCCCCAGGGCAGGCATACACAAATCCGACCTACCATGTT

CCCACCAACGGACCTGGAGAAGCTACAGGCAATGCATCTAGAGCGATG CCTTCGAATCCTGCCCCATCATCAGAATACTGGAGGGTTCTTTGTGGCAGT

ATTGGTCAAGAAAGCACCAATGCCGTGGAACAAACGTCAGCCCAAG GTCCAGAATAAATCTGCAGAAGCCAGAGAACCCAGGGTATCCAGCCATGTGGC

TGCCACAGAGGGAAATCCCAGTGACCAGTCTGAGCTGGAAAGTCAGATGATAACTGGAGCTGGTGACTCAGAAACAGCTCACAACACTGAGAACACAGAG

AGCAATGAGAAGAAAGATGGCGTGTGTGG CCCTCCTCCATCAAAGAAAATGAAGTTGTTTGGATTTAAAGAAGATCCATTTGTATTCATTCCTGAAGAT

GATCCTTTATTTCCACCTATTGA GAAGTTTTATGCCTTGGATCCTTCATTCCCGAGGATGAATCTGTTAACCCGAACCACAGAAGGAAAGAAGCGGCAG

CTTTATATGGTCTCCAAGGAGCTGAGGAATGTACTGCTGAACAACAGCGAGAAGATGAAG GTCATTAACACTGGGATAAAAGTCTGGTGTCGAAATAAC

AGTGGTGAAGAATTCGATTGTGCATTCCGTTTGGCACAGGAG GGAATATATACATTGTATCCATTTATCAATTCAAGAATCATCACTGTATCAATGGAA

GACGTGAAGACACTGTTGACCCAGGAGAACCCATTCTTTAGAAAACTGAGCAGTGAGGCCTACAGTCAAGTCAAGGACCTTG CAAAGGGAAGTGTTGTG

CTGAAGTATGAGCCAGATTCTGC GAATCCAGACACCCTCCAGTGCCCCATCGTGCTGTGTGGGTGGCGGGGAAAGGCCTCTATTCGAACTTTTGTGCCC

AAAAATGAGCGGCTTCATTATCTCAGGATGATGGGTCTGGAGGTACTGGGAGAAAAGAAGAAAGAGGGAGTCATTCTTACCAATGAGAATGCTGCCAGCC

CAGAGCAGCCTGGAGATGAGGATGCCAAGCAGACAGCACAAGACCCCTGCGTCCCAGACTCCGTCCCTGGCTGTGATGCAGCTGCAGCTGAGCCATCCCG

GTGAAGGAGTCTTCACACAATGAATTGGTACCATCCGTTGTTGGAGATCAAACCTAGAATGTCCTTAGCCAGGGACCTGGAAATGAGTGGTGGCCACAGT

CTGTTAGGAGTCGCTTTTGCAGAGTGGATACATGTTTCTGCTGTTAAAGGCTAACAGCCTTTGCAGAAGTTCAGATCCCTTGTTGGCCAGTATTGACCTA

GTCTTCTAAAACGACAGTAAAAGTCTACAAGTCTTTGGGAAGCAGCTCTATCTATCTATGCTTTAATACTTTCTGGACTGCACACCAGTGTGCTGTGCAG

TCATGCTGACACTGAGGTCTCAGGTGACTTCTGTGCCTTTGTGATAAAGGGTGAGATAAGCCATCTCAGAGGGAAGGCTGGTGAATCATGACAGCAGTTT

TGGGGACCGTTTGTGCTTATCCTGGAGTTGTTTTAAGTGGGGTGGAGATTGCTTGGGTCATGAAATAAAGAGCTATTATGATCATGTATCTTGGCATGAG

ACTTGGATTTGCTTTTAGTTGGCTAATGGGAGAGAAAAGCCAGCCCTCTGGTGTCTCATACAGGACTTGAAGCTGGACTGTCAGCCGTGTTTCCCTCGCC

CAGATTCTCCCGGCAGAGTCCTTGCAGGAGCTCTTCCTTCCCTCTGTCTGTAATGCATTTTGTCCGCACAGTTGAGCATCAGTTACACCAATGCTCTTCC

GGCCTCCCTATATGTGCTCTGAGCTAAACAGGCTACCTCTGGGAACTCAGCTGTGCCTTGCTCATAAACGATCAGTCCAGCTGGATTTGATGACTGTTTA

TATGCCCTGGGGAGGGTCATAGGAGCCTCACCTAAATGTCCAGCTGTGCCATTCCTCAAGTTGTATGTAACTCTTCCTTGGGGAGGGACCGGAGGATACA

GGCCAAAGAAGACCAGGGTGGGATTCCATCTCTGTGGCTATGGGAAAGCTGTCATCTGCTGGTTAAAGACTTTGGCACTGCCTTTGCAGGGTAGGGAAAC

CCAAGCCTCTGTAAGTAGCGCTCACCTGCTCTACAAGTAAGCCCAGAAACTCATTGGTTCCCAGAATGAATTCTGGTAGAGCTGTGGAGTGTGGATGAAA

CACTGTTGGGCTCTTAGGAGGAGGGGCAGACTTTGCTTAGTTCCCTGCCCGGGGGAGGCATTTTAGCAGCAGTGGGTCTTTCCTGGCATAGGTCTTACAC

TTGGACCTGACCTTGAGGTGAGTAGATCAATAAGCCGTAGCCATTGCAAGTACCTCACTGTCAAGAAGACGGGTGTCAGCCTCAGCCAGTGCTACCCAGG

CTGCCTCCATCTTGTGACTCCTCCTCTTACAGGGTGCGGGTTAGTTACTTTGTAAAATATTTTTGGGCTTTTAAGTCTAACTAGAGCAGATAGGCAGTGC

AGCTAGGGCTTGTGTTACCATTGGTTGTCACCTCGTGGTGACAGCTTTGCTTGTTGGCAGGCAGGTGTCTGCCATTGTCTTCGTCCTTATTTGTGTCTTA

CAGGGAGGTCTCCTAAGACTTGGTTCTTTTTCCTCATCAGACTTCAACAGCATCAGCATTGTTTTTTGAGACATGATTTTGTTAAGTTTTGACCCTGAGA

ACCTCCTGCTTCAGCCTCCTAGGTACTGGGCTTCTCAGCATGAGTTGCCATGCCAGCTTTGGATGCCGTCCTGTAGAGACCCCCTTAGCAGATGAAACTT

ACTCTGATTCTTGGTCAAATCCTACTGGGAGGACAGGCCGGGTGGCAATCCTGGGTGCCATTCATGCTGTGTGCTTTTCCCTTGGGTTCCAGAATATTTT

AAATGGTTCC
Translation
MESLREPLPATLRITGYKS - UNI29608 - SHAKEILHCLKNKYFKELEDLEVDGQKVEVPQPLSW - UNI12867 - WYPEELAWHTNLSRKIL

RKSPLLAKFHQFLVSETES GNISRQEAVSMIPPLLLNVEPHHK ILDMCAAPGSKTTQLIEMLHADMSVPFPE EGFVIANDVDNKRCYLLVHQAKRLS

SPCIMVVNHDASSIPRLTVDVDGRKEILFYDRILCDVPCS - UNI10691 - SGDGTMRKNIDVWKKWTTLNSLQLHG - UNI29945 - GLQLRI

ATRGAEQLAEGGRMVYSTCSLNPVEDEAVIAALLEKSEG GALELADVSAELPGLKWMPGVSQWK VMTRDGQWFADWHEVPQGRHTQIRPTMFPPTDLE

KLQAMHLERC CLRILPHHQNTGGFFVAVLVKKAPMPWNKRQPK VQNKSAEAREPRVSSHVAATEGNPSDQSELESQMITGAGDSETAHNTENTESNEK

KDGVCG GPPPSKKMKLFGFKEDPFVFIPEDDPLFPPIE EKFYALDPSFPRMNLLTRTTEGKKRQLYMVSKELRNVLLNNSEKMK VINTGIKVWCRNN

SGEEFDCAFRLAQE GIYTLYPFINSRIITVSMEDVKTLLTQENPFFRKLSSEAYSQVKDLA AKGSVVLKYEPDSA ANPDTLQCPIVLCGWRGKASIR

TFVPKNERLHYLRMMGLEVLGEKKKEGVILTNENAASPEQPGDEDAKQTAQDPCVPDSVPGCDAAAAEPSR
Transcript ENSMUST00000109699
Sequence
GTGCGCTCCGCGTGTGCAGCCGCGTGGGCCATGGGGCGGCGGGCGCGGGGCCGGCGGTTCCAGCAGCCGCCGCAGCCTGAGGGCGAGGAAGACGCCAGCG

ACGGCGGCAGAAAGCGAGGCCAGGCG GGCTGGGAAGGTGGCTATCCCGAGATCGTAAAGGAGAACAAGCTCTTCGAGCACTACTATCAGGAACTCAAGA

TCGTGCCAGAGGGAGAATGGGACCAATTCATGGAGTCACTCCGAGAACCTCTCCCAGCCACACTGAGAATCACTGGGTACAAAAG - UNI29608 - C

CATGCCAAAGAGATTCTCCATTGCTTGAAGAACAAGTACTTTAAGGAGTTGGAGGACCTGGAAGTAGATGGACAGAAAGTTGAAGTTCCACAACCACTAA

GCTG - UNI12867 - GTACCCTGAAGAACTTGCCTGGCATACAAACTTAAGTCGGAAAATCTTGAGGAAGTCCCCGTTGTTGGCAAAGTTCCATCAG

TTCCTGGTCAGCGAGACTGAGTCT GGAAACATCAGCCGCCAGGAGGCTGTCAGCATGATCCCCCCACTGCTGCTCAACGTGGAGCCACACCATAAG AT

CTTAGACATGTGTGCAGCCCCTGGATCCAAGACCACACAGTTAATTGAAATGTTGCATGCAGACATGAGTGTGCCCTTTCCAG AGGGATTTGTAATCGC

AAATGACGTGGACAACAAGCGCTGCTATCTGCTCGTCCATCAGGCCAAAAGGTTGAGCAGTCCCTGCATCATGGTGGTAAACCATGACGCATCCAGCATA

CCTAGACTTACAGTAGATGTGGACGGAAGGAAAGAGATTCTCTTCTATGATCGAATTTTATGTGATGTCCCTTGCAG - UNI10691 - TGGCGATGG

CACAATGAGAAAAAACATTGATGTCTGGAAGAAATGGACAACCTTAAACAGCTTGCAGCTCCATGG - UNI29945 - CCTGCAGCTTCGGATTGCAA

CTCGAGGTGCTGAGCAGCTGGCGGAAGGTGGCAGGATGGTGTATTCCACGTGTTCCTTGAACCCCGTGGAGGATGAAGCAGTGATCGCAGCTCTGCTAGA

GAAGAGTGAAG GAGCTCTTGAGCTTGCTGATGTGTCTGCTGAGTTGCCAGGACTGAAGTGGATGCCTGGAGTCTCACAGTGGAAG GTCATGACTAGAG

ACGGGCAGTGGTTTGCAGACTGGCATGAGGTTCCCCAGGGCAGGCATACACAAATCCGACCTACCATGTTCCCACCAACGGACCTGGAGAAGCTACAGGC

AATGCATCTAGAGCGATG CCTTCGAATCCTGCCCCATCATCAGAATACTGGAGGGTTCTTTGTGGCAGTATTGGTCAAGAAAGCACCAATGCCGTGGAA

CAAACGTCAGCCCAAG GTCCAGAATAAATCTGCAGAAGCCAGAGAACCCAGGGTATCCAGCCATGTGGCTGCCACAGAGGGAAATCCCAGTGACCAGTC

TGAGCTGGAAAGTCAGATGATAACTGGAGCTGGTGACTCAGAAACAGCTCACAACACTGAGAACACAGAGAGCAATGAGAAGAAAGATGGCGTGTGTGG 

CCCTCCTCCATCAAAGAAAATGAAGTTGTTTGGATTTAAAGAAGATCCATTTGTATTCATTCCTGAAGATGATCCTTTATTTCCACCTATTGA GAAGTT

TTATGCCTTGGATCCTTCATTCCCGAGGATGAATCTGTTAACCCGAACCACAGAAGGAAAGAAGCGGCAGCTTTATATGGTCTCCAAGGAGCTGAGGAAT

GTACTGCTGAACAACAGCGAGAAGATGAAG GTCATTAACACTGGGATAAAAGTCTGGTGTCGAAATAACAGTGGTGAAGAATTCGATTGTGCATTCCGT

TTGGCACAGGAG GGAATATATACATTGTATCCATTTATCAATTCAAGAATCATCACTGTATCAATGGAAGACGTGAAGACACTGTTGACCCAGGAGAAC

CCATTCTTTAGAAAACTGAGCAGTGAGGCCTACAGTCAAGTCAAGGACCTTG CAAAGGGAAGTGTTGTGCTGAAGTATGAGCCAGATTCTGC GAATCC

AGACACCCTCCAGTGCCCCATCGTGCTGTGTGGGTGGCGGGGAAAGGCCTCTATTCGAACTTTTGTGCCCAAAAATGAGCGGCTTCATTATCTCAGGATG

ATGGGTCTGGAGGTACTGGGAGAAAAGAAGAAAGAGGGAGTCATTCTTACCAATGAGAATGCTGCCAGCCCAGAGCAGCCTGGAGATGAGGATGCCAAGC

AGACAGCACAAGACCCCTGCGTCCCAGACTCCGTCCCTGGCTGTGATGCAGCTGCAGCTGAGCCATCCCGGTGAAGGAGTCTTCACACAATGAATTGGTA

CCATCCGTTGTTGGAGATCAAACCTAGAATGTCCTTAGCCAGGGACCTGGAAATGAGTGGTGGCCACAGTCTGTTAGGAGTCGCTTTTGCAGAGTGGATA

CATGTTTCTGCTGTTAAAGGCTAACAGCCTTTGCAGAAGTTCAGATCCCTTGTTGGCCAGTATTGACCTAGTCTTCTAAAACGACAGTAAAAGTCTACAA

GTCTTTGGGAAGCAGCTCTATCTATCTATGCTTTAATACTTTCTGGACTGCACACCAGTGTGCTGTGCAGTCATGCTGACACTGAGGTCTCAGGTGACTT

CTGTGCCTTTGTGATAAAGGGTGAGATAAGCCATCTCAGAGGGAAGGCTGGTGAATCATGACAGCAGTTTTGGGGACCGTTTGTGCTTATCCTGGAGTTG

TTTTAAGTGGGGTGGAGATTGCTTGGGTCATGAAATAAAGAGCTATTATGATCATG
Translation
MGRRARGRRFQQPPQPEGEEDASDGGRKRGQA GWEGGYPEIVKENKLFEHYYQELKIVPEGEWDQFMESLREPLPATLRITGYKS - UNI29608 - 

SHAKEILHCLKNKYFKELEDLEVDGQKVEVPQPLSW - UNI12867 - WYPEELAWHTNLSRKILRKSPLLAKFHQFLVSETES GNISRQEAVSMIP

PLLLNVEPHHK ILDMCAAPGSKTTQLIEMLHADMSVPFPE EGFVIANDVDNKRCYLLVHQAKRLSSPCIMVVNHDASSIPRLTVDVDGRKEILFYDRI

LCDVPCS - UNI10691 - SGDGTMRKNIDVWKKWTTLNSLQLHG - UNI29945 - GLQLRIATRGAEQLAEGGRMVYSTCSLNPVEDEAVIAAL

LEKSEG GALELADVSAELPGLKWMPGVSQWK VMTRDGQWFADWHEVPQGRHTQIRPTMFPPTDLEKLQAMHLERC CLRILPHHQNTGGFFVAVLVKK

APMPWNKRQPK VQNKSAEAREPRVSSHVAATEGNPSDQSELESQMITGAGDSETAHNTENTESNEKKDGVCG GPPPSKKMKLFGFKEDPFVFIPEDDP

LFPPIE EKFYALDPSFPRMNLLTRTTEGKKRQLYMVSKELRNVLLNNSEKMK VINTGIKVWCRNNSGEEFDCAFRLAQE GIYTLYPFINSRIITVSM

EDVKTLLTQENPFFRKLSSEAYSQVKDLA AKGSVVLKYEPDSA ANPDTLQCPIVLCGWRGKASIRTFVPKNERLHYLRMMGLEVLGEKKKEGVILTNE

NAASPEQPGDEDAKQTAQDPCVPDSVPGCDAAAAEPSR

For any suggestions or comments, please send an email to unitrap@crg.es