Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000021686 (Ap3b1)
Chromosomal location
Chr 13: 95128940 - 95336264 (+)
Description
adaptor-related protein complex 3, beta 1 subunit Gene [Source:MGI Symbol;Acc:MGI:1333879]
RefSeq_dna
NM_009680 
RefSeq_peptide
NP_033810.2 
UniGene
Mm.21185 
MGI
MGI:1333879 
Uniprot/SWISSPROT
Q9Z1T1 
Uniprot/SPTREMBL
Q3TQ07 Q3TQ33 Q3UPG0 
Human Ortholog
ENSG00000132842 (AP3B1)
Omim 203300 - HERMANSKY-PUDLAK SYNDROME  608233 - HERMANSKY-PUDLAK SYNDROME 2  
UniTrap UNI18603
Vector Insertion
Chr 13: 95129187 - 95160746
Public Clones (sanger)
Private Clones OST419842 (lexicon) OST319429 (lexicon) OST66880 (lexicon)
Severity of mutation (?) Insertion after 4% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI8390
Vector Insertion
Chr 13: 95160823 - 95164673
Public Clones RRK483 (baygenomics)
Private Clones OST48367 (lexicon)
Severity of mutation (?) Insertion after 6% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI7980
Vector Insertion
Chr 13: 95164749 - 95173292
Public Clones RRI328 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 8% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI2576
Vector Insertion
Chr 13: 95173389 - 95173901
Public Clones XS0181 (sanger)
Private Clones OST77228 (lexicon)
Severity of mutation (?) Insertion after 11% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI3961
Vector Insertion
Chr 13: 95210369 - 95213873
Public Clones (sanger) AS0127 (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 28% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI1863
Vector Insertion
Chr 13: 95213972 - 95215876
Public Clones AZ0221 (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 31% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI7588
Vector Insertion
Chr 13: 95216093 - 95218407
Public Clones RRR400 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 35% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI8551
Vector Insertion
Chr 13: 95225461 - 95232350
Public Clones RRO297 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 44% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI9666
Vector Insertion
Chr 13: 95253316 - 95263623
Public Clones XG561 (baygenomics) IST12397C5 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 73% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI116
Vector Insertion
Chr 13: 95263697 - 95271872
Public Clones GC0048 (tigem) A070B02 (ggtc) W081F03 (ggtc)
Private Clones not available
Severity of mutation (?) Insertion after 75% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI1896
Vector Insertion
Chr 13: 95271980 - 95298119
Public Clones AA0098 (sanger) AY0450 (sanger) RRO011 (baygenomics) W007B08 (ggtc)
Private Clones not available
Severity of mutation (?) Insertion after 79% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI9691
Vector Insertion
Chr 13: 95302022 - 95312733
Public Clones XG813 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 88% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI38296
Vector Insertion
Chr 13: 95317849 - 95335559
Public Clones (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 95% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000022196
Sequence
CGGCGCGCGCCCCCTCCGCCCCAGAACTAGTTTGGTTCGGTGTCCTCCGAACGCCAGCCATCCGTAGAGGACCCCGCACGCTCTCTCCCGCACCCGCCTG

CTGGCCAGCACCGCCCGCGATGTCTAGCAACAGTTTCGCCTACAACGAGCAGTCGGGAGGAGGGGAGGCGGCGGAGCTCGGGCAGGAGGCCACCTCGACC

ATCTCTCCCTCGGGCGCCTTCGGCCTCTTCAGCAGCGATTGGAAGAA - UNI18603 - GAATGAAGACCTGAAGCAGATGCTGGAGAGCAACAAAGA

TTCTGCCAAGCTAGATGCTATGAAGCGAATTGTTGGG - UNI8390 - ATGATTGCGAAGGGGAAAAATGCCTCGGAACTCTTCCCTGCTGTTGTGAA

GAATGTGGCCAGTAAAAACATCGAG - UNI7980 - ATCAAGAAGTTGGTGTACGTTTACCTTGTCCGATATGCTGAAGAACAGCAGGACCTGGCTCT

TCTGTCCATAAGCACTTTCCAGCGAGCTTTGAAG - UNI2576 - GACCCGAATCAACTAATCCGTGCAAGTGCCTTGAGAGTTTTGTCAAGTATTAG

AGTGCCAATTATCGTGCCTGTCATGATGCTGGCTATTAAGGAGGCTTCAGCTGACCTGTCGCCATATGTTAGGAAGAATGCAGCCCATGCTATTCAGAAG

CTGTACAG TCTTGACCCCGAGCAGAAGGAGATGTTAATTGAAGTCATTGAGAAGCTTCTGAAAGACAAGAGCACG CTGGTGGCTGGCAGTGTGGTGAT

GGCCTTTGAAGAAGTGTGCCCGGATAGAATCGATCTGATTCACAGGAATTACCGAAAGCTTTGTAACCTGCTGGTTGATGTTGAAGAGTGGGGGCAGGTG

GTCATAATCCATATGCTAACAAGATACGCTCGGACCCAGTTTGTCAGTCCTTGGAGAGAG GATGGTGGTCTGGAAGACAATGAGAAGAACTTCTATGAA

TCTGAGGAGGAGGAGGAGGAGAAGGAGAAGAGCAGCAGGAAGAAGTCGTATGCCATGGACCCAGACCACAGACTCTTAATTAGAAACACCAAGCCGTTGC

TTCAGAGCAGGAATGCAGCG - UNI3961 - GTGGTTATGGCTGTCGCTCAGCTATATTGGCACATCTCACCCAAGTCGGAGGCTGGTGTCATTTCTA

AATCACTGGTGCGCTTATTGCGCAGCAATAG - UNI1863 - GGAGGTGCAGTATATTGTATTGCAAAATATTGCAACTATGTCAATTGAGAGAAAG 

GGTATGTTTGAACCTTACCTGAAGAGTTTCTATGTCAGATCCACTGATCCAACTATGATCAAAACACTGAAG - UNI7588 - CTTGAAATTTTGACA

AACTTGGCAAATGAAGCCAACATATCAACTCTTCTTCGAGAATTTCAG ACCTACGTGAGAAGCCAGGACAAACAGTTTGCAGCAGCCACTATTCAGACC

ATAGGCAGATGTGCAACCAGCATTAGCGAGGTCACCGACACATGCCTCAACGGCCTGGTCTGCCTGCTGTCCAACAGGGATG AAATAGTTGTTGCTGAG

AGTGTGGTTGTTATAAAGAAATTGTTGCAAATGCAGCCTGCACAGCATGGTGAAATTATCAGACATATGGCCAAGCTCTTGGACAGTATCACT - UNI8

551 - GTTCCTGTGGCTAGAGCAAGCATCCTTTGGCTAATTGGAGAAAACTGTGAACGAGTTCCTAAAATTGCTCCTGATGTTTTGAGGAAAATGGCTA

AAAGTTTCACTAGTGAAGATGATCTCGTGAAACTGCAGATTTTAAATCTTGCAGCAAAATTGTATTTAACTAATTCCAAACAG ACAAAATTGCTTACCC

AGTACATATTAAATCTCGGCAAGTATGATCAAAACTACGACATCAGAGACCGCACACGATTTATTAGGCAGCTTATTGTTCCGAACGAGAAGAGTGGAGC

CTTAAGTAAATATGCCAAAAAAATCTTCCTAGCACCGAAGCCTGCGCCACTGCTCGAGTCTCCCTTTAAAG ATAGGGATCGCTTCCAGCTTGGCACCTT

ATCTCATACTCTCAACATTAAAGCGTCCGGGTACCTGGAATTATCTAATTGGCCAGAGGTGGCGCCTGACCCATCGGTTCGCAATGTAGAAGTAATAGAG

TCA GCAAAAGAATGGACCCCACTTGGGAAAACAAAGAAAGAAAAACCCATGAAGAAATTTTACTCTGAATCTGAGGAGGAGGAGGACGAGGACGAGGAT

GAGGACGAGGAGGAGGAAGAAAAGGAAGATGAGGATGAGAACCCCTCTGATAGCAGCAGTGACAGTG AGAGCGGGTCCGGAAGTGAGAGTGGAGACACA

GGCACCGAGGACAGCAGTGAGGACTCGTCCAGTGGACAAGACAGCGAGACCGGAAGCCAGGCAGAAGCGGAACGCCAGAAGGTGGCCAAGAGGAACTCCA

AAACCAAGAGGAAAAG TGATTCAGAAAATAGGGAGAAGAAAAATGAAAACTCAAAAGCTTCTGAATCGTCCAGTGAGGAGTCCAGTTCCATGGAAGACA

GTTCTTCCGAGTCAGAGTCAGAGTCAGGCTCTGACAGTGAGCCTGCGCCCAGAAACGTGGCTCCG - UNI9666 - GCAAAAGAAAGAAAACCCCAGC

AAGAAAGACATCCTCCCTCCAAAGATGTTTTCCTTCTAGATCTGGACGACT - UNI116 - TTAACCCAGTATCCACCCCAGTTGCCCTTCCTACACC

AGCCCTTTCTCCAAGCTTGATAGCTGATCTTGAAGGTCTAAACTTGTCAACTTCTTCATCAGTCATCAAC - UNI1896 - GTCAGTACGCCTGTCTT

CGTGCCAACAAAAACACATGAGCTGCTTCACCGAATGCATGGGAAAGGACTGGCCGCCCACTACTGCTTCCCAAGACAGCCCTGCATCTTCAGTGACAAG

ATGGTCTCTGTACAGATCACCCTGACTAATACTTCTGATCGAAAAATAGAAAACATCCACATAGGGGGGAAAGGGCTTCCTGTGGGCATGCAGATGCATG

CCTTTCATCCAATAG ACTCTCTGGAGCCTAAGGGGTCCGTGACTGTCTCAGTGGGTATTGACTTTTGTGATTCTACACAGACGGCCAGTTTCCAATTGT

G - UNI9691 - CACCAAGGATGACTGCTTCAACGTCACCCTCCAGCCACCTGTTGGGGAGCTGCTTTCACCTGTGGCCATGTCAGAGAAGGACTTTA

AGAAGGAGCAAG GAACGCTCACTGGAATGAACGAGACTTCGGCTACACTCATCGCTGCTCCACAGAACTTCACTCCCTCCATGATCCTCCAGAAGGTTG

TAAATGTGGCCAACCTCGGTGCTGTGCCTTCCAGCCAAGATAACGTACACAG GTTTGCAGCTAGAACTGTGCACAGTGGGTCGCTGATGCTAGTCACAG

TGGAACTGAAGGAAGGCTCCACAGCCCAGCTTATCATCAACACCGAGAAAACCGTGATTGGTTCTGTTCTGCTGCGGGAGCTGAAGCCTGTCCTGTCCCA

GGGGTAACCTGCTTACATCTGGACTTCAGAATCTGGCACACAACAAAAGTGCCTGGCACCCACTGCTGCTGCCTTTCATTTATAATAATAGCCCTTCCAT

CTGGCAGCAGGAAGAGCGCACTCTCGACATTCTTGTCTCTGCTTTAGAATGCTGCTGTGTCTGTCATGTGTGCACTCCTCGCCCCTCCTCGCTTTGCTAA

CCAAAGAACATATATTTTACTGTCCATTTCCTCAGCTCCCCAGTCCGAGTAGCATTTTCTCTGCCCTCCGACTTCTTTTGACCTCATCTTCCTTCTGGGT

TTTGAGAACAGTGGGTGTGAATCAGTGCTTGGCAATCGTCCTTCTTACAGCAGTAAGCAAAAATTAGCAAGGAACGTGTCCGCATGGCCTCTCAGCTTGG

TATGTGAAAAGGAAATAGCATACTTTTTCAAAAATAAATAAATAAAAATGGCATCTCTGAAAATCCCATTCTTTGATTTTCCTGGTATTGTAATTGGTTA

TTGACAATTGTCATCATGAAATTACCCCTGAATAATCAGGTAAATAAAGGAGTATATG
Translation
MSSNSFAYNEQSGGGEAAELGQEATSTISPSGAFGLFSSDWKK - UNI18603 - KNEDLKQMLESNKDSAKLDAMKRIVG - UNI8390 - MIAK

GKNASELFPAVVKNVASKNIE - UNI7980 - IKKLVYVYLVRYAEEQQDLALLSISTFQRALK - UNI2576 - DPNQLIRASALRVLSSIRVPI

IVPVMMLAIKEASADLSPYVRKNAAHAIQKLYS SLDPEQKEMLIEVIEKLLKDKST LVAGSVVMAFEEVCPDRIDLIHRNYRKLCNLLVDVEEWGQVV

IIHMLTRYARTQFVSPWRE DGGLEDNEKNFYESEEEEEEKEKSSRKKSYAMDPDHRLLIRNTKPLLQSRNAA - UNI3961 - VVMAVAQLYWHISP

KSEAGVISKSLVRLLRSNR - UNI1863 - REVQYIVLQNIATMSIERK GMFEPYLKSFYVRSTDPTMIKTLK - UNI7588 - LEILTNLANEA

NISTLLREFQ TYVRSQDKQFAAATIQTIGRCATSISEVTDTCLNGLVCLLSNRDE EIVVAESVVVIKKLLQMQPAQHGEIIRHMAKLLDSIT - UNI

8551 - VPVARASILWLIGENCERVPKIAPDVLRKMAKSFTSEDDLVKLQILNLAAKLYLTNSKQ TKLLTQYILNLGKYDQNYDIRDRTRFIRQLIVP

NEKSGALSKYAKKIFLAPKPAPLLESPFKD DRDRFQLGTLSHTLNIKASGYLELSNWPEVAPDPSVRNVEVIES AKEWTPLGKTKKEKPMKKFYSESE

EEEDEDEDEDEEEEEKEDEDENPSDSSSDSE ESGSGSESGDTGTEDSSEDSSSGQDSETGSQAEAERQKVAKRNSKTKRKS SDSENREKKNENSKASE

SSSEESSSMEDSSSESESESGSDSEPAPRNVAP - UNI9666 - AKERKPQQERHPPSKDVFLLDLDDF - UNI116 - FNPVSTPVALPTPALSP

SLIADLEGLNLSTSSSVIN - UNI1896 - VSTPVFVPTKTHELLHRMHGKGLAAHYCFPRQPCIFSDKMVSVQITLTNTSDRKIENIHIGGKGLPVG

MQMHAFHPID DSLEPKGSVTVSVGIDFCDSTQTASFQLC - UNI9691 - CTKDDCFNVTLQPPVGELLSPVAMSEKDFKKEQG GTLTGMNETSAT

LIAAPQNFTPSMILQKVVNVANLGAVPSSQDNVHR RFAARTVHSGSLMLVTVELKEGSTAQLIINTEKTVIGSVLLRELKPVLSQG

For any suggestions or comments, please send an email to unitrap@crg.es