Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000021690 (Jmy)
Chromosomal location
Chr 13: 94204165 - 94269644 (-)
Description
junction-mediating and regulatory protein Gene [Source:MGI Symbol;Acc:MGI:1913096]
RefSeq_dna
NM_021310 
RefSeq_peptide
NP_067285.2 
UniGene
Mm.390630 
MGI
MGI:1913096 
Uniprot/SWISSPROT
Q9QXM1 
Human Ortholog
ENSG00000152409 (AC020898.6)
Omim not available
UniTrap UNI20572
Vector Insertion
Chr 13: 94242750 - 94268256
Public Clones not available
Private Clones OST358313 (lexicon)
Severity of mutation (?) Insertion after 34% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI18437
Vector Insertion
Chr 13: 94229745 - 94234521
Public Clones not available
Private Clones OST423366 (lexicon)
Severity of mutation (?) Insertion after 45% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000065537
Sequence
GCTTTCTGGTTCTGGTTCTGGCTGGCTGGGCGCTGTTGGCCGGGGGCAGAGGGGCGGCGGGGAGGTAGGCCCCGGCGGGCGAGCGGCGGACGCGCGCCTC

AGCACGCAGCCCCGCGGCTCCGCGCAGGCCGGTCCGGCGGCCCAGGGCCCTGCGCTGCGGCAGCGAGCGGCTTGTAAACAGATCCGGCCGCACGTGACCA

TGTGAACTACCTGCTCCGGGCCGCGTATTGTCTCTTCTGAGAGCCGCACCACAAAGGAGCCGGTGGGTGAGCGGCCGGCGCGCTAAGATGGCTGCAGGCG

CCCCGCAAGGGTGAGCTGGGGGCGCGGCCACCGCGGAGACTCGGCCGGGCGGGCGACCCCCCTCGCCGGGCACCGGAGCTACCATGTCGTTCGCGCTGGA

GGAGACACTCGAGTCCGACTGGGTGGCGGTGCGGCCCCACGTATTCGACGAGCGCGAGAAGCACAAGTTTGTGTTCATTGTGGCCTGGAACGAGATCGAA

GGCAAGTTTGCTATAACCTGTCACAACCGGACGGCCCAGAGACAGAGGAGCGGTTCCCGGGAACAGGCGGGGACGCCCGCGTCTGATGGGAGTCGCGGTC

CGGGCAGCCCCGCGGCCAGGGGTCGGTCAGAGGCCGCTGCCTCTGCTACAGCAGCGCTCCGGAGTCCCGGGCCACGGAAAAGCCAGGCCTGGGCCGAGGG

CGGCTCTCCGCGCAGCGCGCGCAGCCTGAAGGGGGATCCTCCTCGGGGTCCCGCGGGCAGAGGACCGGAGAGTCCTCTCCGTAGCCCCGCGCGGGCTAAG

GCCAGCCCGCTCCGCAGAAGCGCCGAATCCCGAGATGCGACCGCCAGTGCCACGCCAGCCCCGCCGGCGCCCCCGGTGCCCCCGGTGTCGTCGGTGCGGG

TGGTGAGTGCCTCCGGGGCGGTCTCCGAGGAGATCGAGGTCCTGGAAATGGTGAGGGAGGACGAGGCGCCACAGCCGCTCCCGGACTCGGAGCAGCCGCC

GTCTGCCGCGGAGCTGGAGTCTCCGGCCGAAGAATGCAGCTGGGCCGGGCTTTTCTCCTTCCAGGATCTGCGAGCCGTGCATCAGCAGCTGTGCTCGGTA

AACTCCCAGCTGGAGCCGTGTCTGCCGGTGTTCCCCGAAGAGCCGTCAGGCATGTGGACGGTGCTGTTTGGGGGCGCCCCCGAGATGACCGAGCAGGAGA

TCGACGCTCTATGTTACCAACTCCAGGTATACCTGGGCCACGGCCTGGACACGTGTGGCTGGAAGATCCTTTCTCAGGTTCTTTTCACCGAGACGGATGA

TCCGGAGGAGTATTACGAAAGCCTCAGCGAGCTGCGGCAGAAGGGCTATGAAGAGGTGCTTCAGCGGGCCAGGAGGCGCATCCAGGAG - UNI20572 

- CTCTTGGACAAGCACAAGACTATAGAAAGCATGGTAGAGCTTTTGGACTTGTATCAGATGGAGGATGAAGCCTACAGCAGCCTTGCAGAGGCCACAAC

TGAACTCTACCAGTATTTACTTCAGCCATTCCGAGACATGCGAGAACTGGCCATGCTACGAAGACAGCAGATCAAG ATTTCCATGGAGAATGATTATTT

GGGCCCTCGAAGAATTGAGAGTCTACAGAAAGAAGATGCTGACTGGCAGCGGAAAGCTCACATGGCTGTTTTGTCTATTCAGGATCTCACCGTCAAATAT

TTTGAAATAACAGCAAAAGCTCAGAAAG - UNI18437 - CTGTGTATGATCGGATGCGAGCAGATCAGAAGAAATTTGGCAAAGCATCGTGGGCAGC

AGCTGCTGAGCGAATGGAAAAACTCCAGTATGCAGTTTCTAAAGAGACTTTGCAGATGATGAGAGCTAAAGAAATTTGTCTGGAACAGAAGAAACATGCA

CTAAAAGAAGAG ATGCAAAGCTTACAGGGTGGTACAGAAGCTATAGCTCGATTGGATCAGCTGGAATCTGACTACTATGATCTGCAACTTCAGTTGTAT

GAAGTACAGTTTGAAATCTTGAAGTGTGAAGAGTTGTTATTAACTGCACAGCTGGAGAGCATCAAGAGACTTATATCAG AAAAGAGAGATGAAGTGGTG

TACTACGACACTTACGAAAGCATGGAGGCCATGCTGGAGAAGGAAGAGATGGCAGCGTCTGTGCACGCCCAGAGGGAAGAGCTACAGAAACTGCAGCAGA

AGGCACGCCAGCTGGAAGCAAGAAGGGGCCGTGTCTCAGCCAAGAAAGCCTACCTCAGAAATAAAAAA GAAATTTGCATTGCAAAACACCATGAGAAGT

TCCAGCAGCGTTTTCAGAGTGAAGATGAATATAGAGCCCATCATACAATACAAATA AAGAGAGACAAATTGCATGATGAAGAGGAAAGAAAAAGTGCCT

GGGTTAGCCAAGAGAGACAGAGGACACTGGATAGACTTCGAACATTTAAGCAG AGGTACCCCGGGCAAGTCATCCTTAAGTCGACCAGATTACGAGTGG

CGCATTCAAGAAGAAAAAGCACAGCAAGCCCTGTGCCCTGTGAGGAGCAGTGTCACTCTCTGCCAACAGTGCTGCAGGGGCAGGAGAAGACAGAGGTGGG

AGGAGGAGGAAGCCAGCTTGGGCCTTCACAGACAGCAGAACCCCAGAGCCTTGTCCAACTTGAAGACACTTCATCAGAACAACTTGAATCCACCTCATTA

CCTCCTCGTGCTGTCGTCAGCTCTGAACTGCCTCCTCCACAGTCAGCTCCACTGTTGACTAGTATTGACCCCAAACCGTGTTCTGTTACTATAGATCCTC

TCCCACCCCCTCTTCCTCCAACACCTCCCCCTCCCCCACCCCCACCCCCACCTCCACCCCCACCCCTGCCTGTTGCAAAGGACAATGGGGCCTCCACCAC

TGCAGAGACACTGGAGAAAGATGCACTTAGGACGGAGGGCAATGAGAGGAGCATCCCAAAGTCGGCCAGTGCCCCCGCAGCACACCTCTTTGATAGCAGC

CAGCTGGTCAGCGCACGGAAAAAGCTCAGAAAGACTGTGGAAGGGCTGCAGAGGAGGAGAG TGAGTTCACCCATGGATGAAGTGTTAGCATCCTTGAAG

CGTGGTAGCTTTCATCTGAAAAAGGTTGAACAGCGGACTCTGCCTCCTTTTCCTGATGAAGATGATAGTAATAATATTTTGGCGCAGATAAGGAAAGGGG

TAAAGTTGAAGAAGGTTCAGAAGGAAGTTTTGAGAGAATCCTTCACACTTCTGCCTGATACCGACCCTTTGACACGGAGTATCCACGAAGCTCTAAGAAG

AATCAAAGAAGCGTCCCCAGAGTCAGAGGATGAGGAAGAGGCTTTGCCGTGCACAGACTGGGAGAACTAGCAG GTGACTTAAGAGAGAAGAAAAATACC

CATGGATGAAGACTGGCTCTGGTTCCTTTGGGGAAAAAATCTAAGCTCTTGGTCCCACAATTGGATTCCATTATGTCCTGAGTATATTGACAAAGTGGTT

TGAAAAAGGAAGCACAAACGGGAGGTTACTACTGTCCAGTCCCTCTCATTGATAGTGCAATGTTCCCGACTGCAGAGAGAACAAGCCTCCTGGAGACGGC

TGTTCCTTCCCCACCCCTCCTCCCCATCTGCCCAATCATAATCTCATAGTGGCCAGTCCCATTGCTATGAATTGGAAGAACACTGGGTTGGCAGAGGTCT

GCTGTACGAGCTACTTTGGGATTCATCTTTCAGTGAACTGAGAAGATCTGTGCTGAAGCACAGCCGCTTCCATGTCAGCTTGTAGAGACAGAGAGACATG

CTACAGAAGACATTGATCAAGGTAGTTATGGTCAGGAATTAAAAAAAAACCATGAAATGCACTTAAAATTTCCACATTATTCATCTCCAGAGAAGTTCAG

TATCTGAGAAGCCAGTGGAGATATACCTATCAATGTGTGCACCAGAACACGACACATTTAACAAGGCATATTTTTAAGAGGCCACAGTCTTACATTTTGT

AAGAATTTGAAGTTAAAATTTCCATGCTTTTAAAATAGCGTTTCATAATTCTGAATTTAGAATAGTTTGAATTTTATGTGCATCCTGTTTATGAGAAGCA

ATGCTTTGTAATTTGATAATGTTATTTTTAGTCTTTTTGTTTGAACTACTGCTTGATTACTATAACTCAAGACTTTCCTATTGAGAATCAAAAAAGCAGG

ATTCAACAGTGGGGATTCAAATTACAAGCCGTGCACCCGGTTACGTTTTTATTGTTATGCTCCGTGGTGAGGAGCATGTATTCAGTAAAGGTCCAGAAGG

CAGCTGGGCCCGAAGCCTCCAGCTGGCATTTTAGTGGTTTTGTTTTTTGTTTTTTTATTCTGTGTATAGAACTTTAGGAGAACGTTTGTTGCTGTCACTA

AATCTTTAAACTCACATGTGTAGATCCAATGCTGACCTGGCTGTATCTTAAAGGGTCCATTTATGAACGGGGCCGGCAGGGATTGTCATTGGTTTGATTA

TGTGAACATGCATGAGGGCAGATATGCTGGACCCAGTTTACAGTACATTGTAGTGTGTGCTTTATATGGAGGAATTGAAATACC
Translation
MSFALEETLESDWVAVRPHVFDEREKHKFVFIVAWNEIEGKFAITCHNRTAQRQRSGSREQAGTPASDGSRGPGSPAARGRSEAAASATAALRSPGPRKS

QAWAEGGSPRSARSLKGDPPRGPAGRGPESPLRSPARAKASPLRRSAESRDATASATPAPPAPPVPPVSSVRVVSASGAVSEEIEVLEMVREDEAPQPLP

DSEQPPSAAELESPAEECSWAGLFSFQDLRAVHQQLCSVNSQLEPCLPVFPEEPSGMWTVLFGGAPEMTEQEIDALCYQLQVYLGHGLDTCGWKILSQVL

FTETDDPEEYYESLSELRQKGYEEVLQRARRRIQE - UNI20572 - LLDKHKTIESMVELLDLYQMEDEAYSSLAEATTELYQYLLQPFRDMRELAM

LRRQQIK ISMENDYLGPRRIESLQKEDADWQRKAHMAVLSIQDLTVKYFEITAKAQKA - UNI18437 - AVYDRMRADQKKFGKASWAAAAERMEK

LQYAVSKETLQMMRAKEICLEQKKHALKEE MQSLQGGTEAIARLDQLESDYYDLQLQLYEVQFEILKCEELLLTAQLESIKRLISE EKRDEVVYYDTY

ESMEAMLEKEEMAASVHAQREELQKLQQKARQLEARRGRVSAKKAYLRNKK EICIAKHHEKFQQRFQSEDEYRAHHTIQI KRDKLHDEEERKSAWVSQ

ERQRTLDRLRTFKQ RYPGQVILKSTRLRVAHSRRKSTASPVPCEEQCHSLPTVLQGQEKTEVGGGGSQLGPSQTAEPQSLVQLEDTSSEQLESTSLPPR

AVVSSELPPPQSAPLLTSIDPKPCSVTIDPLPPPLPPTPPPPPPPPPPPPPPLPVAKDNGASTTAETLEKDALRTEGNERSIPKSASAPAAHLFDSSQLV

SARKKLRKTVEGLQRRRV VSSPMDEVLASLKRGSFHLKKVEQRTLPPFPDEDDSNNILAQIRKGVKLKKVQKEVLRESFTLLPDTDPLTRSIHEALRRI

KEASPESEDEEEALPCTDWEN 

For any suggestions or comments, please send an email to unitrap@crg.es