Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000021743 (Fezf2)
Chromosomal location
Chr 14: 13174616 - 13178342 (-)
Description
Fez family zinc finger 2 Gene [Source:MGI Symbol;Acc:MGI:1859823]
RefSeq_dna
NM_080433 
RefSeq_peptide
NP_536681.1 
MGI
MGI:1859823 
Uniprot/SWISSPROT
Q9ESP5 
Human Ortholog
not available
Omim not available
UniTrap UNI34893
Vector Insertion
Chr 14: 13176862 - 13178343
Public Clones IST15066C3 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000022262
Sequence
AGTTGCCTCCTTTAAAGTTTGAGGGGCGGTGGCGGCGGCCGGCAGGCGCGGGGGAACGCAGGGTCCTCAACGGGAGTCGCGCCGCCGCCCATGTCATTCC

ACTTCAAGTGACTTCATGTGATGTCAGCTGAATGTAAAAGACAGTGATCTCACGCGGAGGGGAAGATGTTTGCCATCAAAATGTGACAGAAGAGACACGC

TGCATGGCTCGGAACGCATCTCCTTGGCGGTGGGGGAAAGAG - UNI34893 - ACTTAGAGGAGAGAGGCTGTGCCCTGGCCCAGCCTGGCCCAGCT

TGGCGCGCCATGGCCAGCTCAGCTTCCCTGGAGACCATGGTGCCCCCGGCCTGCCCGCGCGCTGGAGCGTCACCGGCCACTTCTAAAACACTAGCTTTCT

CTATCGAGCGCATCATGGCCAAGACGTCCGAGCCCCGAGCGCCTTTCGAGCCCCGGCCTGCTGCGTTAGAGGCAGACAGCAGCCAGAGCAAGAAACTGCT

CAACCTCTGCTCGCCGCTGCCCTGTATGATCCCTCTCCAGCCTCTAGGCTACGAGGTGCCGTCCAAGACGCTGCTCAGTTACTCGGAGTTCTGGAAGAGC

AGCCTCCGGGCGGGCGGCGGTGGAGGAGGAGGCAGCGGCGGGGGGGCCCCAGTGTGCGGCGCCAGCGGCTTGTGCAAAACCAACTGTGGCGTGTGCTGCA

AGGCCGAACTGGGCCTCGCGCCTTCTGCGCTGCCCGCCGGCAGGGTCATCAAACCGCAGGTCATCAACCAGGCTGTGGGGCTGCCTGCCAGCGGCTCTCT

CTACTACTTCAACTACCTGGACTCCACCGCTTACCCACCTTCGGAGCTCCTCGGAGGCCACCTTTTCCCATCCGGCCTCCTCAACGCACAGGCCCCCACT

TCCCTGGCTGCTCACCCCAAGCTTTTTCTGCTGGAGAACGCCAAACTGGCCAGCCTGGCTGCGGACAAGTTCCCCCACCCAGCTTCCTATCCCCATAAGG

AGCGCTTGCATGCGCCACTGGAGCAGGTGCTGAAGGAGAACTCGGCCTTGACAGCTGAACGAGGGGGAGTCAAGAGCCACAGCAAACTACCGGGGGGCTC

TACTGACAGCAAACCCAAAAACTTCACCTGCGAAGTGTGCGGCAAG - UNI34893 - GTGTTCAATGCTCACTATAACCTCACCCGCCACATGCCTG

TCCACACCGGAGCTAGACCGTTTGTGTGCAAAGTCTGTGGCAAAGGCTTCCGCCAGGCCAGCACTCTCTGCAGACACAAAATTATCCATACCCAG GAAA

AACCACATAAGTGTAACCAGTGCGGCAAAGCCTTCAATCGCAGCTCCACGCTCAACACGCACATCCGCATCCACGCGGGCTACAAGCCCTTCGTCTGCGA

GTTTTGTGGCAAAGGCTTTCACCAAAAAG GGAACTACAAGAATCACAAGCTCACCCACAGCGGCGAGAAGCAGTACAAATGCACTATCTGTAACAAGGC

CTTCCATCAGGTCTACAATCTGACCTTCCACATGCACACCCACAACGACAAGAAGCCTTTCACGTGTGCCACTTGCGGCAAAGGTTTTTGCAGAAACTTT

GACTTAAAGAAACATGTGCGCAAACTTCATGACAGCGTGGGTCCCACCGCCACCCCCTCAGCAAAGGACCTAGCCAGGACAGTTCAGAGCTGAGAGCTAC

TGCCTTGTCCGTTCTTCCTGCCCTGTACCAACCCAAGCAGATCTCACGTATAAACTTATTTCTAAAATTAAAAGAAAAAAAAACTATAGCAGAGAGGCTA

AAATCTATTTATCGAAACCAGCATATTTTTGGGGAAATGTAAACGTGTCCTCGATGACCGGCACAAACGCGTGGCTCCCACCTTTGTACATTCAGGAAAC

GTATTTAAATCCAGTGCGCTGAAACATATTTAATTCCAGGCCTCCGCTTCTCCTCAGGCAGCCGGCTTTTAATCCCAGCCTGTCACCGTGAGCGCCCAGA

AGAGCGTGATGCCCCTGCCATCTTCACTCAACCTTGTAATCTCTCCTGTACAAGCGAACACGGAATATTACATATATATGACTCAAT
Translation
 - UNI34893 - MASSASLETMVPPACPRAGASPATSKTLAFSIERIMAKTSEPRAPFEPRPAALEADSSQSKKLLNLCSPLPCMIPLQPLGYEVPSK

TLLSYSEFWKSSLRAGGGGGGGSGGGAPVCGASGLCKTNCGVCCKAELGLAPSALPAGRVIKPQVINQAVGLPASGSLYYFNYLDSTAYPPSELLGGHLF

PSGLLNAQAPTSLAAHPKLFLLENAKLASLAADKFPHPASYPHKERLHAPLEQVLKENSALTAERGGVKSHSKLPGGSTDSKPKNFTCEVCGK - UNI3

4893 - VFNAHYNLTRHMPVHTGARPFVCKVCGKGFRQASTLCRHKIIHTQ EKPHKCNQCGKAFNRSSTLNTHIRIHAGYKPFVCEFCGKGFHQKG G

NYKNHKLTHSGEKQYKCTICNKAFHQVYNLTFHMHTHNDKKPFTCATCGKGFCRNFDLKKHVRKLHDSVGPTATPSAKDLARTVQS

For any suggestions or comments, please send an email to unitrap@crg.es