Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000021745 (Ptprg)
Chromosomal location
Chr 14: 12386046 - 13074555 (+)
Description
protein tyrosine phosphatase, receptor type, G Gene [Source:MGI (curated);Acc:Ptprg-001]
RefSeq_dna
NM_008981 
RefSeq_peptide
NP_033007.2 
UniGene
Mm.475030 Mm.405384 Mm.431266 
MGI
MGI:97814 
Uniprot/SWISSPROT
Q05909 
Uniprot/SPTREMBL
Q3UND4 
Human Ortholog
ENSG00000144724 (PTPRG)
Omim not available
UniTrap UNI16496
Vector Insertion
Chr 14: 12386847 - 12553628
Public Clones (sanger) E056D06 (ggtc) D106D08 (ggtc) D134A02 (ggtc) D117F10 (ggtc)
IST13453H11 (tigm) IST13958C12 (tigm) IST14522A3 (tigm) IST12437C4 (tigm)
Private Clones OST459725 (lexicon) OST386352 (lexicon) OST329565 (lexicon) OST146994 (lexicon)
OST118466 (lexicon) OST66049 (lexicon) OST60967 (lexicon) OST55256 (lexicon)
OST54079 (lexicon) OST50715 (lexicon) OST49883 (lexicon) OST38522 (lexicon)
OST36160 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI10238
Vector Insertion
Chr 14: 12553734 - 12785229
Public Clones (sanger) GST098 (baygenomics) D127B12 (ggtc) E112H09 (ggtc) D088C03 (ggtc)
E087F03 (ggtc) D124B08 (ggtc) E055A08 (ggtc) D093F05 (ggtc) IST13310E3 (tigm)
IST14272G8 (tigm) IST13264E10 (tigm) IST12748G2 (tigm) IST12987G7 (tigm)
IST12236F4 (tigm) IST14484A9 (tigm) IST13265B1 (tigm) IST13150H7 (tigm)
IST11004A5 (tigm) IST10280B8 (tigm) IST15026C11 (tigm) IST12068A11 (tigm)
Private Clones OST469586 (lexicon) OST142086 (lexicon) OST43348 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI27186
Vector Insertion
Chr 14: 12795237 - 12869854
Public Clones IST12172E11 (tigm) IST14810H12 (tigm) IST12172E9 (tigm)
Private Clones OST67566 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI30647
Vector Insertion
Chr 14: 12923996 - 12942489
Public Clones IST10637G1 (tigm) IST12049B8 (tigm) IST11966F9 (tigm) IST11100H12 (tigm)
IST15056F3 (tigm) IST11603E6 (tigm) IST11509E7 (tigm) IST12651B5 (tigm)
IST10262E10HMF1 (tigm) IST11903G2 (tigm) IST12930A1 (tigm) IST10732B9 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI33417
Vector Insertion
Chr 14: 12942648 - 12954491
Public Clones IST10748A10 (tigm) IST14582G9 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI38481
Vector Insertion
Chr 14: 12999392 - 13011777
Public Clones (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI2584
Vector Insertion
Chr 14: 13023288 - 13032235
Public Clones XS0144 (sanger) IST10266C10BBF1 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 7% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI6721
Vector Insertion
Chr 14: 13039895 - 13042781
Public Clones HMA495 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 16% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI34610
Vector Insertion
Chr 14: 13058969 - 13069542
Public Clones IST13434A7 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 86% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000119888
Sequence
AGTGACGTGGATGCTGGAAAGCTGAGGGCTGGCCAGCATCTCAGGCAGAGGCTGCGTGAACTGCTCATAGCCTTTCTGTTCACTGCCTGTCCTATGATGA

CCACTGTGTGCTCCCTGCTTTGCTTGAAGTACAG AAAATGTTTTCAGACTGCTCATTTCTATGTGGAAGACAGCAGTTCACCTCGGGTGGTCCCCAACG

AAAGTGTTCCTATTATTCCCATCCCGG - UNI2584 - ATGACATGGAAGCCATTCCTGTCAAACAGTTTGGTAAACACATCGGTGAGCTCTATTCCA

ATAGCCAGCATGGCTTCTCGGAAGATTTTGAG GAAGTCCAGCGCTGTACAGCTGATATGAACATCACTGCAGAGCATTCCAATCATCCGGATAACAAGC

ACAAAAACAGATACATCAACATTTTAGCAT - UNI6721 - ATGATCACAGTAGGGTGAAGTTAAGACCTTTACCAGGAAAGGACTCTAAGCACAGCG

ACTACATTAATGCAAACTATGTCGAT GGTTACAACAAAGCGAAAGCCTACATTGCCACCCAGGGACCTTTAAAATCCACCTTTGAAGACTTCTGGAGGA

TGATCTGGGAACAAAACACGGGAATCATCATCATGATCACGAACCTCGTGGAGAAAGGAAGG AGAAAGTGTGATCAGTATTGGCCAACGGAGAACACTG

AGGAGTACGGGAACATTATTGTCACACTGAAGAGCACAAAAGTACATGCCTGCTACACCGTCCGTCGTCTTTCAGTTAGAAACACAAAAGTGAAAAAG G

GCCAGAAGGGCAACCCCAAAGGTCGTCAGAATGAGCGGACGGTGATCCAGTACCACTACACACAGTGGCCTGACATGGGTGTCCCTGAGTACGCCCTCCC

AGTCCTGACCTTCGTGAGGAGGTCATCTGCGGCCCGCATGCCAGACATGGGGCCCGTGTTGGTGCACTGCAG CGCTGGTGTGGGCAGGACAGGCACCTA

CATTGTAATAGACAGCATGCTGCAGCAGATCAAAGACAAAAGCACAGTTAATGTCCTGGGCTTCCTGAAGCATATCAGGACACAGAGGAACTACCTCGTC

CAGACTGAG GAGCAGTACATTTTCATCCATGATGCCTTGTTGGAAGCCATTCTCGGGAAGGAAACTGAAGTATCTTCAAGTCAGCTGCATAGCTATGTT

AACAGCATCCTCATACCAGGAGTAGGAGGAAAGACACGGCTGGAAAAGCAGTTTAAG CTGATCACGCAGTGTAATGCAAAGTATGTGGAGTGCTTCAGT

GCCCAGAAGGAGTGCAACAAAGAGAAGAACAGGAACTCGTCTGTTGTGCCAG CTGAGCGTGCTCGAGTGGGACTTGCACCGTTGCCCGGGATGAAAGGA

ACAGATTACATTAATGCTTCTTACATCATG GGGTATTATAGAAGCAACGAGTTCATCATAACCCAGCATCCTCTGCCACACACTACGAAAGATTTCTGG

AGAATGATTTGGGATCATAATGCACAGATCATTGTCATGCTGCCAGACAACCAGAGCCTG GCAGAAGATGAGTTTGTGTACTGGCCGAGTCGTGAGGAA

TCCATGAACTGTGAGGCCTTTACTGTCACCCTCATCAGCAAAGACAGGCTATGCCTCTCGAATGAAGAACAAATTATCATCCATGACTTCATCCTTGAAG

CTACACAG GATGACTACGTACTAGAGGTTCGGCACTTTCAGTGTCCCAAATGGCCTAACCCAGATGCCCCTATAAGTAGTACCTTCGAACTGATCAATG

TCATCAAGGAAGAGGCCTTAACCCGGGATGGCCCCACCATTGTTCATGATGA - UNI34611 - GTATGGAGCAGTTTCTGCAGGAATGTTGTGTGCC

CTTACCACCTTGTCCCAGCAGCTAGAGAATGAAAATGCTGTGGATGTGTTCCAGGTGGCAAAAATGATCAATCTTATGAGACCTGGAGTATTCACAGACA

TT GAACAATACCAGTTTGTCTACAAAGCAATGCTCAGCTTGATCAGTACTAAAGAAAATGGAAATGGTCCCATGACCGGGGACAAAAACGGTGCTGTGC

TAACTGCAGAGGAATCAGACCCTGCAGAGAGCATGGAGTCTCTGGTGTGACTAGTCCCCTGGAAGGGCACTTCATTTGTAAACTTCTGAGACTTGTAAAG

ACAGAAATTTTTTGAGGCCTTTTTTGCCAGACTCTAGGTTATACAATAACCCAGTTACTTTTTTACACTGATAAAAGTTTTGATATTTATTTTTTGCCAT

TTTCTGTCTTAATGGTATCCTACTGAGCATTTGCGCCTGTTCTTCATTTCACACAGTGAAACGCAACTTTACCTAGTTTGCACTATATGATCAGTGTTAA

CTGCCTATAATCTAATACTACAGAAACCCTGATGTGACATTCCATGACCACATACATGCTATTTTTTAGTTCCGTGCAGTGAAGGTCTTTGTTATGACAG

TGAATCTCAGTTTTACTATTATTCTAAAGCAACTACAATTTCTTAGCAGGCAACAGTGTACTTTTCTCAGTCCCCTCTATTTTTTAGGCACTGTTCAATA

CTACATGCCTTCTGTTTTAATGGAGTGGATGGGCGTTGTCTCCTTTTGCAGGACAGCAGGTGACTGGGAGCCCTATAGATCTGTTGGCATCAGTTCCATT

TGTAATGGTTGAGGGACCACTAAGAAGTTAAGAGGGCTTCAGAGTTACTTCATGTGAACATCTCTTATTAGTTACCAAGTTATATTCACAGTTGAAATGT

GTCAAAATAAAGAATCATTCTGTATTACAGATTTCACAGT
Translation
MMTTVCSLLCLKYR RKCFQTAHFYVEDSSSPRVVPNESVPIIPIPD - UNI2584 - DDMEAIPVKQFGKHIGELYSNSQHGFSEDFE EVQRCTAD

MNITAEHSNHPDNKHKNRYINILAY - UNI6721 - YDHSRVKLRPLPGKDSKHSDYINANYVD GYNKAKAYIATQGPLKSTFEDFWRMIWEQNTGI

IIMITNLVEKGR RKCDQYWPTENTEEYGNIIVTLKSTKVHACYTVRRLSVRNTKVKK GQKGNPKGRQNERTVIQYHYTQWPDMGVPEYALPVLTFVRR

SSAARMPDMGPVLVHCS SAGVGRTGTYIVIDSMLQQIKDKSTVNVLGFLKHIRTQRNYLVQTE EQYIFIHDALLEAILGKETEVSSSQLHSYVNSILI

PGVGGKTRLEKQFK LITQCNAKYVECFSAQKECNKEKNRNSSVVPA AERARVGLAPLPGMKGTDYINASYIM GYYRSNEFIITQHPLPHTTKDFWRM

IWDHNAQIIVMLPDNQSL AEDEFVYWPSREESMNCEAFTVTLISKDRLCLSNEEQIIIHDFILEATQ DDYVLEVRHFQCPKWPNPDAPISSTFELINV

IKEEALTRDGPTIVHDE - UNI34611 - EYGAVSAGMLCALTTLSQQLENENAVDVFQVAKMINLMRPGVFTDI EQYQFVYKAMLSLISTKENGNG

PMTGDKNGAVLTAEESDPAESMESLV
Transcript ENSMUST00000022264
Sequence
ATGTTACTTCCTGTATGGAGGCATGGCCAGTTTCCAGCCCCGCGCTCTCGGTTCCTCCCCAGCCTGCGCCGGAGCCACAACTTTCAGGAGCATGGACTGA

AGGCGCCCTCGCCCCGGCGCCCCTCTGAGATCCTTTGTGTTTCCCTGCGCTCCACTGGCCGTTTGTGTTTTGGGGGGCTCTGCGCTCCGCCCCGCCGCTT

CCCTCCCTTTCCAGGCTCGCAGACATGCCTCCTTCCTTGCCGGGGCCCTGGAAGGAGCTGCCCGCCTGAAGCCCGGAGCCGCCGCGCCGCGCACAGCCCC

GCCGTCGCCCGCTGGTTCTCGGGCTGCGCTGCGCTGCCGACTCAACTTGGGGCTCTTCCGCTGCTAGCCACCGCCACCCGCGGTCCCTGCCTGCTCCGGG

CCCCGGGCTCTGCCGCCGTGCGTCTTCTCCTCGCCCTGCCTGTCGGCTGGATCGTGTCTGAGCGGAAAGCAGCCCTTCTCCTCCGAGAGGATCGTCCCTA

GCTTGGCTTTGCATTCCCGGTCACTTTTTGAGGTTTTCTCGGGAGCGCTTGGCAGCTTCCCGGATTCCAGCGGGACCGGTGGCCGAGTGTGGGGGGCCCC

GTGTGGCGGGCGAGCCGTGAAAGCCTCCAGGCTTAGCGGAGCCTCGCTCGGAAGCAAGAACTTATTCAACAAGTTTACCCCCCCTGCCTTTCTCTTTTCG

ATGTGCGTTTTCGGACATGCGGAGGTTACTGGAACCGTGTTGGTGGATTTTGTTCCTGAAAATCACCAGTTCTGTGCTTCATTATGTGGTGTGCTTCCCG

G - UNI16496 - CATTGACTGAAGGCTATGTGGGGACCCTGCAGGAGAGCAGACAGGACAGCTCAGTGCAGATCCGCAGACGAAAGGCATCCGGAGA

CCCATACTGGGCGTATTCTG - UNI10238 - GTGCCTATGGTCCTGAGCACTGGGTCACATCTAGTGTCAGCTGCGGGGGCAGCCATCAGTCTCCTA

TAGACATTTTAGACCACCATGCTCGCGTTGGCGATGAATACCAGGAGCTTCAACTTGATGGGTTTGACAACGAGTCCTCTAACAAAACCTGGATGAAAAA

TACAGGGAAAACAG TTGCCATCCTGCTGAAAGACGATTATTTTGTGAGTGGTGCCGGACTGCCGGGCAGATTCAAAGCTGAGAAGGTGGAGTTTCACTG

GGGCCACAGCAATGGCTCCGCTGGCTCAGAGCATAGTGTCAATGGCCGGAGGTTTCCTGTGGAG - UNI27186 - ATGCAGATTTTCTTTTACAACC

CAGACGACTTTGACAGCTTTCAAACGGCAATTTCTGAGAACAGAATAATTGGAGCTATGGCCATATTTTTCCAA GTCAGTCCGAGGGACAATTCTGCAC

TGGATCCTATTATCCACGGGCTGAAGGGCGTCGTACATCACG - UNI30647 - AGAAGGAGACTTTCCTGGATCCTTTCATTCTCCGAGACCTCCTG

CCCGCATCCCTGGGGAGTTATTACAGGTACACAGGCTCCTTGACTACGCCACCCTGTAGTGAAATAGTGGAGTGGATTGTCTTCCGGAGGCCCGTTCCCA

TCTCCTATCACCAG - UNI33417 - CTTGAGGCTTTTTATTCTATCTTCACCACGGAGCAGCAAGACCATGTCAAGTCAGTGGAGTACCTGAGAAAT

AACTTCCGACCACAACAAGCTCTGAATGACAGAGTGGTGTCAAAGTCTGCTGTCCGGGATGCCTGGAACCATGACCTGGCAGACTTCTTGGACAACCCAC

TAGGCACAGAAGCCTCTAAAG TTTGCAGCTCTCCGCCCATCCACATGAAGGTGCAGCCTCTGAACCAGACAGCTCTGCAGGTGTCCTGGAGCCAACCTG

AAACCATCTACCACCCGCCCATCATGAATTACATGATCTCCTATAGCTGGACCAAGAATGAGGACGAGAAGGAGAAGACATTTACAAAAGACAGTGACAA

GGACTTG AAAGCCACCATCAGCCATGTCTCACCCGATAGCCTTTACCTATTCCGAGTACAGGCTGTGTGTAGGAATGACATGCGGAGTGACTTCAGCCA

GACAATGCTCTTTCAAG CTAATACTACCCGGATCTTCCAAGGGACCAGGATTGTGAAAACAGGAGTG CCGACAGCCTCTCCTGCCTCTTCAGCAGACA

TGGCCCCCATCAGCTCTGGCTCTTCCACTTGGACATCCTCCGGCATCCCCTTCTCATTTGTTTCCATGGCAACTGGGATGGGCCCTTCCTCCAGTGGCAG

CCAAGCTACAGTGGCCTCTGTGGTCACCAGCACACTGTTGGCAGGCCTGGGCTTCGGTGGTGGTGGCATCTCCTCCTTCCCCAGTACCGTGTGGCCCACG

CGCCTTCCCACCGCATCTGCAGCCAGCAAGCAGGCAGGGAGGACAGTTCTTGCCACCACCGAGGCCTTAGCTTCCCCTGGGCCGGATGTCGACTCGGCAC

CGACGAAGGACAGCGAGGGTACAGAGGAGGGAGAGAAGGAGGAGAAAAGCGAGAGCGAGGATGGTGAGCGAGAGCATGAGGAGGAAGAGAAGGACTCTGA

GAAGAAGGAGAAGAGTGAGGCTACTCACACAGCCGCAGAGAGTGACCGGACTGCACCTGCCCCCACCCCCTCTTCCCCTCATAGGACTGCAGCGGAGGGA

GGACATCAGACTATACCTGGGCGCAGGCAGGACCACTCTGCCCCTGCCACAGACCAGCCGGGCCACGTTGCCCCAGACTTGGATCCCCTTGTGGACACAG

CCACCCAAGTGCCCCCAACAGCCACAGAGGAACATTATTCAGGGAGTGATCCCAGGAGGCCCGAAATGCCATCTAAAAAGCCTATGTCCCGAGGGGACCG

ATTTTCTGAGGATAGCAAATTCATCACAGTTAACCCAG CTGAGAAGAACACCTCTGGCATGCTAAGCCGCCCCTCCCCCGGGAGGATGGAGTGGATCAT

CCCCCTGATTGTGGTCTCAGCCTTGACCTTCGTGTGCCTCGTCCTCCTCATTGCCGTGCTGGTGTACTGGAG AGGGTGTAACAAAATAAAGTCCAAGGG

CTTTCCCCGACGTTCCCGTGAAGTGCCTTCTTCTGGGGAGAGAGGAGAGAAGGGGAGCAG AAAATGTTTTCAGACTGCTCATTTCTATGTGGAAGACAG

CAGTTCACCTCGGGTGGTCCCCAACGAAAGTGTTCCTATTATTCCCATCCCGG - UNI2584 - ATGACATGGAAGCCATTCCTGTCAAACAGTTTGG

TAAACACATCGGTGAGCTCTATTCCAATAGCCAGCATGGCTTCTCGGAAGATTTTGAG GAAGTCCAGCGCTGTACAGCTGATATGAACATCACTGCAGA

GCATTCCAATCATCCGGATAACAAGCACAAAAACAGATACATCAACATTTTAGCAT - UNI6721 - ATGATCACAGTAGGGTGAAGTTAAGACCTTT

ACCAGGAAAGGACTCTAAGCACAGCGACTACATTAATGCAAACTATGTCGAT GGTTACAACAAAGCGAAAGCCTACATTGCCACCCAGGGACCTTTAAA

ATCCACCTTTGAAGACTTCTGGAGGATGATCTGGGAACAAAACACGGGAATCATCATCATGATCACGAACCTCGTGGAGAAAGGAAGG AGAAAGTGTGA

TCAGTATTGGCCAACGGAGAACACTGAGGAGTACGGGAACATTATTGTCACACTGAAGAGCACAAAAGTACATGCCTGCTACACCGTCCGTCGTCTTTCA

GTTAGAAACACAAAAGTGAAAAAG GGCCAGAAGGGCAACCCCAAAGGTCGTCAGAATGAGCGGACGGTGATCCAGTACCACTACACACAGTGGCCTGAC

ATGGGTGTCCCTGAGTACGCCCTCCCAGTCCTGACCTTCGTGAGGAGGTCATCTGCGGCCCGCATGCCAGACATGGGGCCCGTGTTGGTGCACTGCAG C

GCTGGTGTGGGCAGGACAGGCACCTACATTGTAATAGACAGCATGCTGCAGCAGATCAAAGACAAAAGCACAGTTAATGTCCTGGGCTTCCTGAAGCATA

TCAGGACACAGAGGAACTACCTCGTCCAGACTGAG GAGCAGTACATTTTCATCCATGATGCCTTGTTGGAAGCCATTCTCGGGAAGGAAACTGAAGTAT

CTTCAAGTCAGCTGCATAGCTATGTTAACAGCATCCTCATACCAGGAGTAGGAGGAAAGACACGGCTGGAAAAGCAGTTTAAG CTGATCACGCAGTGTA

ATGCAAAGTATGTGGAGTGCTTCAGTGCCCAGAAGGAGTGCAACAAAGAGAAGAACAGGAACTCGTCTGTTGTGCCAG CTGAGCGTGCTCGAGTGGGAC

TTGCACCGTTGCCCGGGATGAAAGGAACAGATTACATTAATGCTTCTTACATCATG GGGTATTATAGAAGCAACGAGTTCATCATAACCCAGCATCCTC

TGCCACACACTACGAAAGATTTCTGGAGAATGATTTGGGATCATAATGCACAGATCATTGTCATGCTGCCAGACAACCAGAGCCTG GCAGAAGATGAGT

TTGTGTACTGGCCGAGTCGTGAGGAATCCATGAACTGTGAGGCCTTTACTGTCACCCTCATCAGCAAAGACAGGCTATGCCTCTCGAATGAAGAACAAAT

TATCATCCATGACTTCATCCTTGAAGCTACACAG GATGACTACGTACTAGAGGTTCGGCACTTTCAGTGTCCCAAATGGCCTAACCCAGATGCCCCTAT

AAGTAGTACCTTCGAACTGATCAATGTCATCAAGGAAGAGGCCTTAACCCGGGATGGCCCCACCATTGTTCATGATGA - UNI34611 - GTATGGAG

CAGTTTCTGCAGGAATGTTGTGTGCCCTTACCACCTTGTCCCAGCAGCTAGAGAATGAAAATGCTGTGGATGTGTTCCAGGTGGCAAAAATGATCAATCT

TATGAGACCTGGAGTATTCACAGACATT GAACAATACCAGTTTGTCTACAAAGCAATGCTCAGCTTGATCAGTACTAAAGAAAATGGAAATGGTCCCAT

GACCGGGGACAAAAACGGTGCTGTGCTAACTGCAGAGGAATCAGACCCTGCAGAGAGCATGGAGTCTCTGGTGTGACTAGTCCCCTGGAAGGGCACTTCA

TTTGTAAACTTCTGAGACTTGTAAAGACAGAAATTTTTTGAGGCCTTTTTTGCCAGACTCTAGGTTATACAATAACCCAGTTACTTTTTTACACTGATAA

AAGTTTTGATATTTATTTTTTGCCATTTTCTGTCTTAATGGTATCCTACTGAGCATTTGCGCCTGTTCTTCATTTCACACAGTGAAACGCAACTTTACCT

AGTTTGCACTATATGATCAGTGTTAACTGCCTATAATCTAATACTACAGAAACCCTGATGTGACATTCCATGACCACATACATGCTATTTTTTAGTTCCG

TGCAGTGAAGGTCTTTGTTATGACAGTGAATCTCAGTTTTACTATTATTCTAAAGCAACTACAATTTCTTAGCAGGCAACAGTGTACTTTTCTCAGTCCC

CTCTATTTTTTAGGCACTGTTCAATACTACATGCCTTCTGTTTTAATGGAGTGGATGGGCGTTGTCTCCTTTTGCAGGACAGCAGGTGACTGGGAGCCCT

ATAGATCTGTTGGCATCAGTTCCATTTGTAATGGTTGAGGGACCACTAAGAAGTTAAGAGGGCTTCAGAGTTACTTCATGTGAACATCTCTTATTAGTTA

CCAAGTTATATTCACAGTTGAAATGTGTCAAAATAAAGAATCATTCTGTATTACAGATTTCACAGTAGCTATGTGGACAGTGTGTGTTATTTCTATGTTG

ACTCTCTGAAGTAGCAAACCCTAAAATCAGGGCTGTCTTTTACAATGGGAAGATGGCCTTATTTTACACAATTTACTTATGACACTCTTTAGTTAACTCA

ACTATAGCTTTTTGGTAAATAGTACCATAGTAGCTACAACCACAAAATAGGTATTGACATTTAAACGTAGTCTTTGAAAAGTCCCTACTAACTACTCCTA

TAGCAATCTAATAAACACTACCTATAGACAGCATTTTTTTTGCCAAATGTTTCATAATAAATCTCTTAATTACATCCAACTCTACTTAAGATTGAATTGG

AAATATATTTGGGAGTCAATTTTTATAGGTCTTACTTTGAGAAAGAAATAGGAATCTTAAAGAGAAAATCCAGTTCTTGAATGAAAGATGGCATCTCCAT

TTTAGACTGGGTTTTAAGGAAGAGATGCGGATGCTCACAAACAAATGTACATTTATAAAAGATGGCAGTAGTCATTAGGAAGCCCAGAGGCCAGTGTCTG

GAGCTACTTTCAGCACGTAGTACATATGGGCAAACTGGAAGCATTATTTCGAAATTTCACTTGAGTTTGTTTAAAACAAAACAAAATCCACTAAGCTATT

AATCAGGATCTGTATCTTCCTTCTCCTCTTTGCTTTTGAAAGTCAACTTCTGCCAGAATTGAAATCCCCCAAGATTGGTTTCTTCTTTATGACAAAAGCT

TTCTGAAGAGGAGGGCAGCATCTCAGTGTGAATGCGGCTTTATTGTTCGTGGGTTGTTTTTTGGAACTAGTCACAGAAGTGCTGGAGAGCCAGAGCTGGT

AAGGAGAGAGTCACAGGCCAAGCCCAGAGCTTTCAACGCATGGACCAGGCCAATAGAGCCCCATGAAGATAGTGTGTGCACAAAGACCTAAGAGAACACA

CAGAGAATTGGGAGGCTGGCTTTCAAAACTGGTGAGCAGCTGAGCCGAATCCACTAACATATCTGTGCTAGATGGATTTACCAACCCCTGCAGCCCCACC

AGAGGGGTCACCTCTGCACAATACAAAGGATTGACCATAAGAAACATAACTCTTAGAGGCTGTGGGAAATAAGGAAGGAAAAGGTTTCAGATTGTGGTAT

GAGCTTCCCAGTCAATCGAGCAGATTCTTTTTGCTGTGCACAGATCTGATCTTAGCTAATGCTTTTCAGTTAGATGCTCAGTGGAATTAACATTTGAATT

GGAGTTCAGTCTCTCAATTGTCTCGTAGTAAAAATAACATTGTCTAGAAGACAAATGGCAAGTATTACTTCTGTGCTGTTTACACAAGATTCAATTCATG

AAAATGCATACTCTACAGTTCTGGGGCTCTCTCTTACACGAGTGAAAGAAGAATGGGAGAAAGGGAGAAAGAAGTACAACAGAAGTACAATCAAGGCGGG

GGAGAGGCTTCCTGTGGGCAGCCTACATGTCTACAGCAGGCTTGAGCCAAAGCCTACAGATGCCAGCCTACTGGACTACATGCAGTTGCTATGTGCCCAT

TTTGCCAAAGTGGTCCACACGCCCTTTACTGGGGGTGATAGTTACCTTCAGCTCTCTTCAGTCCTCACATTCACCACAATTTGTATGTTCACTATTCTTT

GCTATTGGCAAAAATGTTTTTGCATCTTTCCAGAGGCAAAGAGTTCCAAAGATGTTTTCTTTGAGACATAAGCACGTGGCTTAAGTATATAAGGTTAGTA

CTATTTACAGTCGAGGGAAAAGATATAACTATTGGTAAAGCTAGTGTGAAAGTTTATGAGATATGCTGGTTTTATGAATTTACCTCTAGGGAAATGAAAT

ATACAAACCAAATGAAGCGGAATTGTTATAATTTGATCAGGTGGATGTGCAGGATATCACAGATGTATTAGAGACACCCGAAAAGTTTCTTGTACCTCAA

ACCATAATATCATCTTTGATAGTTCATATATATATAAATATATATATATATATATATATATATATCCTTCTGAGTTTCAAGAATAAGTACAGCTTAGTTT

GGTGGTTTTCCTAAACTTTATATGAGCTTTGAGAGCCTGTGTTAAATAGAAGAGTCCAGCAAGGTCAAAAACCCCAAAAGTTATATATAGTGTTCAAGGT

AAAAAGAAGGGTTCTGGTGTTGAAAGTCTGGTTTGTAGCTTTTACCCCAGAGTGACAGTGAAGCCAGTGAGTAACCATCATTGTTTTATAATAACATAGC

ACAACTGCCTTCTCATGACCTTTTCATAAATGCATATATACTATGTTTAAAATATAGATACCACTTTACCAAAGATACACATTACTAATTCTAAGCAAAA

AAAGAAAAAAAAAGATATTAAAAAAAACCTCGAACTCATAATACTTTTAAAAAGTAATCAAAATGTAGTTCTGTTATCGCTTTGCAGTTATGCTGGTGAA

TGCCTTCTCAACCCCGGTGTTCTAAAGTTTCTGTTCAAACGGTGCCAGTACATTTTTATATGAAGGGAATGCCTGCTTTTTTCCTCCATAGCAGCTGTAA

TTCATGTAGCCCTTTGTACTTTCCCTTAGTCCCCACTTAACACACAGCATTGGCTTTATTTATCTCTATAAAGAAGGCATGGTAAAAAAAAATAACTAAT

AAAAAATTATAATGACATTTGGCCTCTACTTTTGTCTTAGCTGTTAAAATGTTTTTAGTATTTTTGTTAAATATTTGCAAAGGGAAGAATTTTCTACAGA

GGATAATTAATTTCAAGAAAAATATCTTGAGTTTTAAGGAATAAACATCTCCAGAAAAGGAGACAGTCAATTTTATAAAATGTCGTAACTCTCCAACATT

TGGGGTAGTGACTCCTTTTTTGTTAGGACATTTGAAACTAGCAAGTAGCCGTTGTTTCTAAAGAGCCCCACTTCATGTCAACTCCTGTTTCTTTAACTTC

ATTTTCAAACAGTTTAAAACATTAAACCTGTAAATATTTTGTTGCTTGAGTAAGCATCTTCTGGAAGCTTTGTATCTATGGTATATAATCATAGAATTTT

ATATTTTCATATAAAGCTAATTTTTTTCTAGTTTCAACTATGTCATAGTTCTTTTAGTTGTTGGTGCCCCTCTCCCCCGTGGTGGATATGTGAACTTCTG

TGTATTGAAGTAGCAAGAACCATCTTTGCATTCCAAAAGAATCCGTGTGTTCTTCCTTTGGGGTAGTGATTGTGAAAATCGGGTGTTCTTTTTAATTCCA

TTGATCATTAGTGCAATAGCAATTAGACATCACTAGTCACTGAATACATTTGTCACATGGACCCATTTTGGAAAAAGTGATTTTTTTTTTTAAAGAATTG

TTCTGTGGGGGGAGGGGTTTTATAACCTGAAATTTTTTCCCTTTTTCCTTCTGTTTAAAACTATATCAAATCATTCTATTATAGTGTTATTTAATATGTA

AATTGTATTGCTATACATAAAATAAAGTATGGTTTTTGATGTAC
Translation
MRRLLEPCWWILFLKITSSVLHYVVCFPA - UNI16496 - ALTEGYVGTLQESRQDSSVQIRRRKASGDPYWAYSG - UNI10238 - GAYGPEH

WVTSSVSCGGSHQSPIDILDHHARVGDEYQELQLDGFDNESSNKTWMKNTGKTV VAILLKDDYFVSGAGLPGRFKAEKVEFHWGHSNGSAGSEHSVNGR

RFPVE - UNI27186 - MQIFFYNPDDFDSFQTAISENRIIGAMAIFFQ VSPRDNSALDPIIHGLKGVVHHE - UNI30647 - EKETFLDPFIL

RDLLPASLGSYYRYTGSLTTPPCSEIVEWIVFRRPVPISYHQ - UNI33417 - LEAFYSIFTTEQQDHVKSVEYLRNNFRPQQALNDRVVSKSAVRD

AWNHDLADFLDNPLGTEASKV VCSSPPIHMKVQPLNQTALQVSWSQPETIYHPPIMNYMISYSWTKNEDEKEKTFTKDSDKDL KATISHVSPDSLYLF

RVQAVCRNDMRSDFSQTMLFQA ANTTRIFQGTRIVKTGV PTASPASSADMAPISSGSSTWTSSGIPFSFVSMATGMGPSSSGSQATVASVVTSTLLAG

LGFGGGGISSFPSTVWPTRLPTASAASKQAGRTVLATTEALASPGPDVDSAPTKDSEGTEEGEKEEKSESEDGEREHEEEEKDSEKKEKSEATHTAAESD

RTAPAPTPSSPHRTAAEGGHQTIPGRRQDHSAPATDQPGHVAPDLDPLVDTATQVPPTATEEHYSGSDPRRPEMPSKKPMSRGDRFSEDSKFITVNPA A

EKNTSGMLSRPSPGRMEWIIPLIVVSALTFVCLVLLIAVLVYWR RGCNKIKSKGFPRRSREVPSSGERGEKGSR RKCFQTAHFYVEDSSSPRVVPNES

VPIIPIPD - UNI2584 - DDMEAIPVKQFGKHIGELYSNSQHGFSEDFE EVQRCTADMNITAEHSNHPDNKHKNRYINILAY - UNI6721 - Y

DHSRVKLRPLPGKDSKHSDYINANYVD GYNKAKAYIATQGPLKSTFEDFWRMIWEQNTGIIIMITNLVEKGR RKCDQYWPTENTEEYGNIIVTLKSTK

VHACYTVRRLSVRNTKVKK GQKGNPKGRQNERTVIQYHYTQWPDMGVPEYALPVLTFVRRSSAARMPDMGPVLVHCS SAGVGRTGTYIVIDSMLQQIK

DKSTVNVLGFLKHIRTQRNYLVQTE EQYIFIHDALLEAILGKETEVSSSQLHSYVNSILIPGVGGKTRLEKQFK LITQCNAKYVECFSAQKECNKEKN

RNSSVVPA AERARVGLAPLPGMKGTDYINASYIM GYYRSNEFIITQHPLPHTTKDFWRMIWDHNAQIIVMLPDNQSL AEDEFVYWPSREESMNCEAF

TVTLISKDRLCLSNEEQIIIHDFILEATQ DDYVLEVRHFQCPKWPNPDAPISSTFELINVIKEEALTRDGPTIVHDE - UNI34611 - EYGAVSAG

MLCALTTLSQQLENENAVDVFQVAKMINLMRPGVFTDI EQYQFVYKAMLSLISTKENGNGPMTGDKNGAVLTAEESDPAESMESLV

For any suggestions or comments, please send an email to unitrap@crg.es