Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000021767 (Myst4)
Chromosomal location
Chr 14: 22319076 - 22491354 (+)
Description
MYST histone acetyltransferase monocytic leukemia 4 Gene [Source:MGI Symbol;Acc:MGI:1858746]
UniGene
Mm.469611 Mm.471076 
MGI
MGI:1858746 
Uniprot/SWISSPROT
Q8BRB7 
Uniprot/SPTREMBL
Q6ZQC7 Q14AW2 Q3UXM1 
Human Ortholog
ENSG00000156650 (MYST4)
Omim not available
UniTrap UNI11806
Vector Insertion
Chr 14: 22320301 - 22336096
Public Clones F046C07 (ggtc) P104C08 (ggtc) P148D10 (ggtc) (ggtc) IST11773E2 (tigm)
IST11571A3 (tigm) IST10728D10 (tigm)
Private Clones OST240287 (lexicon) OST132529 (lexicon) OST67845 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI688
Vector Insertion
Chr 14: 22335847 - 22336508
Public Clones DC0197 (sanger) XS0571 (sanger) CJ0297 (sanger) AC0738 (sanger)
AW0603 (sanger) RRN310 (baygenomics) (egtc)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI3389
Vector Insertion
Chr 14: 22339527 - 22428975
Public Clones XP0100 (sanger) (sanger) AN0683 (sanger) D068A12 (ggtc) IST14530C10 (tigm)
IST13793F1 (tigm)
Private Clones OST426231 (lexicon) OST411248 (lexicon) OST373709 (lexicon) OST364698 (lexicon)
OST364690 (lexicon) OST349123 (lexicon) OST340798 (lexicon) OST314395 (lexicon)
OST266431 (lexicon) OST191304 (lexicon) OST182456 (lexicon) OST126760 (lexicon)
OST63240 (lexicon) OST33314 (lexicon)
Severity of mutation (?) Insertion after 11% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI16457
Vector Insertion
Chr 14: 22429085 - 22438112
Public Clones CMHD-GT_510B9-3 (cmhd) CMHD-GT_453B7-3 (cmhd)
Private Clones OST460810 (lexicon) OST433481 (lexicon) OST365101 (lexicon) OST63550 (lexicon)
Severity of mutation (?) Insertion after 13% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI22743
Vector Insertion
Chr 14: 22438229 - 22438439
Public Clones not available
Private Clones OST285924 (lexicon)
Severity of mutation (?) Insertion after 15% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI9319
Vector Insertion
Chr 14: 22438522 - 22441176
Public Clones XH464 (baygenomics) XG365 (baygenomics) XG598 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 17% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI6010
Vector Insertion
Chr 14: 22450686 - 22453697
Public Clones CSH520 (baygenomics) RRQ141 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 33% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI178
Vector Insertion
Chr 14: 22453860 - 22456768
Public Clones GC0187 (tigem) A036D04 (ggtc)
Private Clones not available
Severity of mutation (?) Insertion after 36% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI220
Vector Insertion
Chr 14: 22456863 - 22479964
Public Clones GC0655 (tigem) HMA154 (baygenomics) CSJ235 (baygenomics) CSD188 (baygenomics)
Private Clones OST422981 (lexicon)
Severity of mutation (?) Insertion after 37% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000096222
Sequence
AATCAGTGTCATGTCGGATTCATGTCAACGACAACAACAGGGGGACACAAAATGGCGGCGGCTTAGCTCCTACCCCTGGCGGCGGCGGCAGCGGTGGCGG

GCGCTACGGCACCTCCTCCAGGCGGCAGCCGTAGCTTCTTTCTCAGGCAGATTCAGCGCCCCCGGCAGGCGCGGTGGTGGTGGCGCGCGGCCAG - UNI

688 - - UNI11806 - GTCTTGGTTTCCTAAAGATGTCTTTCACTTGAAGAGTGCAGTCCTTCCCATTGGTGAACTAAGACAACTCTCCACGTTGCC

TGGCAGTCAGTCCTCTCTTTAAGGATGGTTGTCCCTATGCTGTTGCTTCACATGGGCTGGGATCCTCTGCCCTTGTGTTGAATTGTGACTTTGGAATGTG

CAGGTTGTGTTAAGTACAAGGCGAATCTCTATGGGTAACGTCTGTGTTGGAGAAGCCATTTGTCAACCATGGTAAAACTTGCAAACCCACTTTACACAGA

GTGGATTCTTGAAGCAGTGCAGAAAATCAAGAAGCAGAAGCAGCGGCCCTCAGAAGAGAGGATCTGCCATGCGGTCAGCACGTCCCATGGGTTGGACAAG

AAAACAGTCTCGGAACAGCTGGAACTTAGTGTTCAGGATGGCTCCGTTCTCAAAGTCACCAACAAAGGCCTTGCTTCATATAAGGACCCAGACAATCCTG

GGCGTTTTTCATCGGTTAAACCGGGCACTTTCCCCAAGCCAACCAAGGGGTCCAAAGGACCGCCGTGTAATGATCTACGCAATGTGGATTGGAATAAACT

TTTAAAGAGAGCAATCGAAGGCCTTGAGGAGCCAAACGGCTCCTCCTTGAAGAACATTGAGAAGTATCTGAGAAGCCAGAGTGATCTTACAGGCACCACC

AACCATCCAGCCTTTCAGCAGAGGTTGCGGCTAGGGGCCAAGCGTGCTGTGAACAATGGGAGGTTACTGAAGGAAGGACCACAGTACAGGGTCAATAGTG

GGAGCTCAGATGGCAAAGGGGCGCCCCAGTACCCCAGTGCTTTTCCGTCCTCACTCCCGCCCGTCAGCCTTCTACCCCATGAGAAAGACCAGGTGAGTGA

GCCCGGCGGTATCGACGCCCTGGAGATATTACTGTTTTACCTTTCGCTTCCACTTAGGCGTGCTCAGCCTGTGGGTCCCAACCCTTTCGGCAAACATCTA

TCTCCCCAAATAGTTACATTACAATTCATAACAGTAGCAAAATTATAGTATATAAAGAATAATTTTATAGTTGGCTGTATTAAACGGTCCCAGCATTAGG

AGGCTGAGAACTACCGATGTGGACGGAAGATCTGAATGGAGTTTGAAAAGATCAGTTGTTTGTGCCTTGAAGCTGGTTTTTATAATTTATATTAGGATGT

TTCATAGCATGATTGTTTAAACATCATTTTATGACACATTGAGGGTTTCTTCAGTGGCTAATAGTTAACATAATACTCACCTGACTTGCTTTATGTTGTA

ACTACCAGGTAAACTTGAATCTACCTTCTTCAAGCCCAAGAAAGGAAAGTGTGGGAGTTTTTCTTCCCTTAATTGTAGAGAGAAAAACCTCCATACTTAT

TTTAATACTGAGAATCTTTGCATAATGTGTGACCTAAATCCCTTCTGTTTAAAGCCATTTATTGTCAGTGGTCAGTGTGTGTTTGGTGTATTTGTCTATT

TTTGTGTTTGTGTGCACACATACCTGCGAGCCCTAGTGCACATGAGGAGGTCTGGGGACAGTTGCAGGTGTTCTTTCCTTCCACTCGGTAGGTCCTGGAG

ATCAAACTCAGGTTGATAGGCAGCAACTTTACCACTGAGCTGTGTTGATTGATGGCCCAAGGCTTTATGTTAGTTTTATAGCATTGTAAGTGTGTGACAG

AGTTTTGTTTCTGCTGAGATTTTTAAGTCTTCAGTTGGGTGTGATTTTCTTTGTTTTATTTTAAACTTACTGAATTAATTTCCCAAAGTCATGCTGAAGT

AGAACAGCAGATTGCAAGTCAGGTCCTCCAGGTTTTGTATTCCTTTCCCAACTTTTGGTCAAGTGCACTCATCGATAGGATGACATTGAGCATCGTGAAT

AGGAAGCGACTGTGCCTGTAAGCTGCTTGCTGAGAAGTATTGAAAGCCAGGTGTCAGGCTCTGTGGGAAGGGTGTCTGCCTGTTCCCATGACGAGGCCTT

CATTTTGTCTCAGCTCCTATGAGACCCAAGTATTAGCAAAACTGGTTTGCTTCTGTTCTTCTGGTACAAAGAACTCATGAAATGGGCCGTTTCCCTTTTT

TGCTTACCTAGTAGGGGCCTACCTCTGAACTAAGGAAGACCCTTCACACAGGTATCTGAAGTCTAGAATGGATTTCTTAGCTGTGTTCATACCTTCTTGG

TCTCCCACAACATTTATTTATTCATTGATTGTGGATGTATCAAAAATGAAGTAAACTATGAAATTTTCTTCATAACTGTCCTTTAAAAAACGACAGGCTC

TTAGCTCTTGCCTCTCTCTTACTCTTGCCCCCCCCCCTTGCTCCCCATTCCCCTCCCCCTCTCTCCTTCTCTCTGCCTTTCTCTGCCTCTGCTACCCTCT

TAACTCCCGTCCCCATGCCCTAGATAAACTATTCTATACTTTTAAAAAATTACAGAAAATGACTTATTTGAATTCCTGAACACAGCCATTTAGATACCTG

TTTCTCCTTGAATCTTTTTTTTAAAATTAAAAACAGTTTAAATCTTTACTGAATTCTTTAGAGATACCTGGCTGTTCTGGAGCTCTGAATTTAGCCCAGG

CTGGCCTCAAACACAGACTCTCCTGCTTTTGCTTCTGAGTGCTGAGGTGGAATTCTTTAAGGGAATCCAGAGCCATTCCTTCATAAGCTTGATTATCTTT

ATTTTTTATCCTCGGCCATGGCAAAGTTGCATAATTATCAGGGACATGGTCTCCATTCAGGCACTGTGGCCAGTTTTGTGTCTTTATGAATAATTGTAGA

CTCTGGAGGGAGGCATTTTCTGGGTCTGGAGCGGGCAGGACAGGTTCTCCAAAGCTCCCCTCCTTCTCTGCAACCTTGCTCATCATTTCTTGCTAGCCTT

ATCTTTTCTCTTCAGGCAGCATCTGTACAGAACTATTTTTAGTCTAAAGGCAAAATTCATGTTTGAAAGAGTCTAGGAGAGAGAACTGAGACATTTATTG

CTTAGCATGCAATTGCAGTTGCTTTTTCTAGGATGTAGATCTTTTAGCTGTCCAGTTAGCATCGTTATTTAACAAGGAAAATTGAGAAAACATGCTCCAG

AATATTTAGTTGATAAAATTTGGGGATTAATTGTATCAAGTAATCATAATAAGATTTTGATGGTATTTTATTAGTGAGCAATCTAGCCTCAACCTAATAT

TAATATGCATGCACACATACATACAAACATGTTATTTTTTAGATAAAATCTCATTATGTGTGTAGCGCAGACTGTCTTGGAACTCTGTAGTTAGCAGAGA

GCCCCCTCCCCCTTTTTGAGACAGGATCTCACTCTACAGTAGTGATGGCTGGCCCTGAATGCTTTATGCAGATCATGCTGGCCTCAACTTACAGAAATCT

TCCTGCTTCTGCCTCCTGAGTGCTGGCATTAAAGGTGTGCACCACCATCCCTGGCTTTCTTTTTAAATGTTGGATGTCTTCCTCTATTGCTCTCCACTGT

AATTTTTGAGATAGGATTTGTCACTGGCTATATGGGCTGCCAAGTAATATACCCACCTTCTCAGAGATAGGATTCCAGACGGGCACCCACTGTAGCCAGC

CTTGTTTTCTTGAGTGCTGGGGATCTGAACTCAGATTCTCGTGCTTGTGAGGTGAGTACTATACCCACTGCACCATCGCTCCATCCCCGATTTCATTT
Translation
 - UNI688 - - UNI11806 - MVKLANPLYTEWILEAVQKIKKQKQRPSEERICHAVSTSHGLDKKTVSEQLELSVQDGSVLKVTNKGLASYKDPD

NPGRFSSVKPGTFPKPTKGSKGPPCNDLRNVDWNKLLKRAIEGLEEPNGSSLKNIEKYLRSQSDLTGTTNHPAFQQRLRLGAKRAVNNGRLLKEGPQYRV

NSGSSDGKGAPQYPSAFPSSLPPVSLLPHEKDQVSEPGGIDALEILLFYLSLPLRRAQPVGPNPFGKHLSPQIVTLQFITVAKL
Transcript ENSMUST00000112458
Sequence
ATGGTAAAACTTGCAAACCCACTTTACACAGAGTGGATTCTTGAAGCAGTGCAGAAAATCAAGAAGCAGAAGCAGCGGCCCTCAGAAGAGAGGATCTGCC

ATGCGGTCAGCACGTCCCATGGGTTGGACAAGAAAACAGTCTCGGAACAGCTGGAACTTAGTGTTCAGGATGGCTCCGTTCTCAAAGTCACCAACAAAGG

CCTTGCTTCATATAAGGACCCAGACAATCCTGGGCGTTTTTCATCGGTTAAACCGGGCACTTTCCCCAAGCCAACCAAGGGGTCCAAAGGACCGCCGTGT

AATGATCTACGCAATGTGGATTGGAATAAACTTTTAAAGAGAGCAATCGAAGGCCTTGAGGAGCCAAACGGCTCCTCCTTGAAGAACATTGAGAAGTATC

TGAGAAGCCAG - UNI178 - - UNI220 - - UNI688 - - UNI3389 - - UNI6010 - - UNI9319 - - UNI16457 - - UNI2

2743 - CCATACGCCCAGCAGCCAATGCAGACCCCACCCCACGCTAACATGATGTACACGGCCCCCGGACACCACGGCTACATGAACACAGGCATGTCC

AAACAGTCTCTCAATGGGTCCTACATGAGAAGGTAG
Translation
MVKLANPLYTEWILEAVQKIKKQKQRPSEERICHAVSTSHGLDKKTVSEQLELSVQDGSVLKVTNKGLASYKDPDNPGRFSSVKPGTFPKPTKGSKGPPC

NDLRNVDWNKLLKRAIEGLEEPNGSSLKNIEKYLRSQ - UNI178 - - UNI220 - - UNI688 - - UNI3389 - - UNI6010 - - UNI

9319 - - UNI16457 - - UNI22743 - PYAQQPMQTPPHANMMYTAPGHHGYMNTGMSKQSLNGSYMRR
Transcript ENSMUST00000069648
Sequence
GGACCCGGGCGGCTGGCAAAGGACGAGGCGGAGGCTGAGGAAGGCAGCGGGGAGACCCGGTCTGCAGCAACAAAGGGCAGCAAGCGATTGGCCGGGCTGG

AGGCGAG - UNI688 - - UNI11806 - GTCTTGGTTTCCTAAAGATGTCTTTCACTTGAAGAGTGCAGTCCTTCCCATTGGTGAACTAAGACAAC

TCTCCACGTTGCCTGGCAGTCAGTCCTCTCTTTAAGGATGGTTGTCCCTATGCTGTTGCTTCACATGGGCTGGGATCCTCTGCCCTTGTGTTGAATTGTG

ACTTTGGAATGTGCAGGTTGTGTTAAGTACAAGGCGAATCTCTATGGGTAACGTCTGTGTTGGAGAAGCCATTTGTCAACCATGGTAAAACTTGCAAACC

CACTTTACACAGAGTGGATTCTTGAAGCAGTGCAGAAAATCAAGAAGCAGAAGCAGCGGCCCTCAGAAGAGAGGATCTGCCATGCGGTCAGCACGTCCCA

TGGGTTGGACAAGAAAACAGTCTCGGAACAGCTGGAACTTAGTGTTCAGGATGGCTCCGTTCTCAAAGTCACCAACAAAGGCCTTGCTTCATATAAGGAC

CCAGACAATCCTGGGCGTTTTTCATCGGTTAAACCGGGCACTTTCCCCAAGCCAACCAAGGGGTCCAAAGGACCGCCGTGTAATGATCTACGCAATGTGG

ATTGGAATAAACTTTTAAAGAGAGCAATCGAAGGCCTTGAGGAGCCAAACGGCTCCTCCTTGAAGAACATTGAGAAGTATCTGAGAAGCCAGAGTGATCT

TACAGGCACCACCAACCATCCAGCCTTTCAGCAGAGGTTGCGGCTAGGGGCCAAGCGTGCTGTGAACAATGGGAGGTTACTGAAGGAAGGACCACAGTAC

AGGGTCAATAGTGGGAGCTCAGATGGCAAAGGGGCGCCCCAGTACCCCAGTGCTTTTCCGTCCTCACTCCCGCCCGTCAGCCTTCTACCCCATGAGAAAG

ACCAG - UNI3389 - CCCCGTGCCGATCCCATTCCAATATGTAGCTTCTGTTTGGGGACTAAAGAGTCAAATCGTGAAAAGAAACCAGAAGAACTCC

TGTCTTGTGCAGATTGTGGCAGTAGTG - UNI16457 - GACACCCATCCTGTCTGAAGTTTTGTCCTGAGTTAACCGCAAATGTGAAGGCCTTGAGG

TGGCAGTGCATCGAGTGCAAGACGTGCAGCGCATGTCGAGTCCAGGGCAAAAATGCA - UNI22743 - GATAACATGCTTTTTTGTGATTCCTGTGA

TAGAGGATTCCATATGGAGTGCTGTGACCCACCACTTTCCAGAATGCCAAAAG - UNI9319 - GGATGTGGATTTGCCAAGTCTGCAGACCAAAGAA

AAAGGGAAGAAAACTACTTCATGAGAAAGCTGCACAAATAAAACGGCGATATGCAAAACCCATTGGACGACCGAAAAATAAATTAAAGCAACGATTGTT 

GTCTGTAACCAGTGATGAAGGATCCATGAGTGCATTCACAGGAAGGGGGTCACCTGGTAGGGGTCAAAAGACTAAAGTCAGTACCACACCTTCATCTGGT

CATGCTGCGTCTGGGAAGCACTCAAGCAGCAGATTGGCTGTTACAGACCCCACCCGGCCTGGTGCCACCACCAAAACCACCACCTCCTCCACCTACATTT

CTGCCTCTACACTTAAAGTTAACAAGAAAACCAAAGGGCTCATTGATGGCCTTACTAAGTTTTTTACACCATCACCTGATGGTCGCAGATCCCGAGGTGA

AATAATAGACTTTTCAAAGCACTATCGTCCAAGGAAAAAGGTCTCTCAGAAACAGTCATGCACTTCTCATGTGTTGGCTACAG ATACTGATATTAAAAT

AAGCATCAAACAAGAAAGTGCAGATGTGAGTCTGGTGGGAAACAAGGAGCTCGTGACTGAAGAGGATCTGGACGTTTTTAAGCAGGCCCAGGAACTGTCT

TGGGAG AAAATAGAGTGTGAAAGTGGAGTGGAAGACTGTGGTCGGTACCCCTCAGTAATAGAGTTCGGGAAATACGAGATCCAAACCTGGTACTCCTCG

CCTTACCCACAGGAATATGCAAG ATTACCAAAGCTTTACCTGTGTGAATTCTGTCTTAAATATATGAAGAGTAAAAATATTTTGCTAAGACACTCAAAG

AAGTGTGGATGGTTTCATCCTCCGGCCAATGAGATTTACCGAAGGAAAGACCTTTCAGTATTCGAG - UNI6010 - GTTGATGGGAATATGAGTAAA

ATTTATTGCCAAAACCTTTGCTTGTTAGCCAAGCTCTTCCTGGACCACAAAACATTGTATTATGATGTTGAGCCATTCCTTTTTTATGTCCTTACAAAAA

ATGATGAAAAAGGCTGTCATCTGGTTGGATACTTCTCCAAG - UNI178 - GAAAAGCTCTGCCAGCAGAAGTATAATGTGTCCTGCATAATGATCAT

GCCCCAGCACCAAAGGCAAGGATTTGGACGCTTTCTCATTGATTTCA - UNI220 - GCTATTTGCTTTCTCGAAGAGAAGGCCAAGCAGGGTCTCCC

GAAAAGCCGCTCTCTGACCTGGGCCGGCTCTCCTACCTGGCCTACTGGAAAAGTGTCATCTTGGAATACCTCTACCGCCACCACGAGAGGCACATCAGCA

TCAAGGCCATTAGCAGAGCCACAGGCATGTGCCCACATGACATCGCCACCACTCTGCAGCACCTCCACATGATTGACAGGAGGGATGGCAG GTTTGTCA

TCATTAGAAGGGAAAAGTTGATATTGGGCCACATGGAAAAGCTGAAGAACTGTTCCCGACCCAATGAACTTGATCCGGAGAGTCTAAGATGGACCCCAAT

GTTAATTTCTAATGCTGTGGTTTCTGAGGAAGAGCGAGAAGCTGAGAAGGAG GCTGAACGACTAATGGAACAAGCCAGCTGCTGGGAGAAGGAGGAGCA

AGAGATCCTGTCGTCCAGAGTTAGCAGTAGGCAATCGTCTGCAAAAGTACAATCAAAGAATAAGTACCTGCACTCCCCAGAGAGGCGGCCAGTGGCCGGG

GAGCGAGGACAGTTGTTAGAGCTGTCCAAAGAGAGCAGTGAGGAAGAGGAGGAGGAGGAGGAGGAAGATGATGAGGAAGAGGAGGAGGAGGAAGAGGAGG

AGAGCATTCAGACATCTCCCCCTCGGTTGACTAAGCCACAGTCAGTTTCCATTAAAAGAAAG AGGCCTTTTGTAGTAAAGAAGAAAAGGGGTCGTAAAC

GCAGGAGGATCAACAGCAGTGTCACCACCGAGACCATTTCCGAGACGACAGAAGTGCTCAATGAGCCCTTCGACAACTCGGATGAGGAGAGGCCAATGCC

GCAGCTGGAGCCTACCTGTGAGATCCCAGTGGAGGAGGGCGGCAGGAAGCCAGTTCTGAGGAAAGCATTCCCACATCAGCCAGGGAAGAAAAGGCAGACA

GAGGAAGAGGAAGGGGAAGACAATCATTTCTTCAAGACCGCTGCCCTTTGTAGAA AAGATGTAGATGATGATGCAGAACACTTGAAAGAAGGCAGCAAA

GACAATCCTGAGCCTCTAAAGTGCAGACAAGTGTGGCCAAAAGGAGCGAAGCGAGGGCTCTCCAAGTGGAAGCAAAGCAAGGAGAGGAAGACGGGCTTCA

AGCTGAACCTGTACACCCCACCAGAGACACCCATGGAGCCAGAGGACCAGGTGACGATCGAAGAGCAGAAGGAGCTTTCAGAGGACAAGGGCAGCCCCGT

GGGGATGGAACGGGAGGTGACAGAGACCGTGGATGCCTTGCTGCCTCAGGAGGGGAGCAGAAGGGAAGAGACAGGCATACCCGTGAGTCCACATAAATCA

CCAGGTGGAAAGGTAGATGAGGAGGACCTCATCAGAGGTGAGGAGGAGGGAGAGGAAGAGGGAGAGGAGGAGGGAGAACGAGAAGAACAGGAAGAGGAAG

AAGAAGTAACTACAGAAAAAGACCTAGATGGTGCTAAAAGTAAAGAGAACCCGGAGCCTGAGATCTCCATGGAAAAGGAAGACCCTGTGCATCTGGGTGA

CCATGAAGAGGACGAGGATGAGGAGGAAGAGCCATCTCACAATGAGGACCATGATGCAGATGATGAAGATGATGGCCACATGGAGGCTGCCAACATGGAG

AGGGGAGACCTCCCAAGAGAAACCTTCAAAGACGCACTAGAGGGCCAGGAGGCTTTTTTAGACCTGAGCATTCAGCCGAGTCACTCGAACCCTGAAGTCT

TGATGAACTGCGGTGTTGATCTCACAATGTCCTGTAACAGTGAGCCAAAGGAGCTTGCTGGGGACACTGGAACTGCACCTGAGTCTGACGCGGAGCCCCC

GGAAGAACAGACACAGAAGCAGGACCAAAAGAACAGCGATGGTGTGGATGCTGAGCTCGAAGAGGGAGGCCCAGCCGCTGTGGAAATTGACTCCGAGACC

GCCCAGGCTGTTCAGTCTTTGACCCAAGAAAACAGGGAGCACGATGACACCTTTCCAGATTGTGCTGAGACTCAAGAGGCCTGTAGAAGCCTGCAGAACT

ATACACACACAGACCAAAGTCCTCAAATTGCCACCACGCTGGACGAGTGCCAACAGTCAGACCACAGTAGCCCAGTTTCATCTGTCCATTCCCATCCTGG

CCAGTCAGTTCGTTCTGTCAATAGCCCCAGTGTCCCTGCCCTAGAGAATAGCTATGCCCAAATCAGCCCCGATCAGACTGCCATCACAGTGCCACCTCTG

CAGAACATGGAGACCAGTCCAATGATGGACGTCCCGTCAGTGTCAGATCACTCACAGCAGGTCGTTGACAGCGGATTCAGTGACCTGGGCAGTATTGAGA

GCACAACAGAGAACTATGAGAACCCAAGCAGCTATGACTCAACCATGGGAGGCAGTATCTGTGGAAACGGCTCTTCCCAGAACAGCTGCTCCTACAGCAG

TCTCACCTCTAGCAATCTGACACAGAACAGCTGTGCTGTCACCCAGCAGATGTCCAACATCAGTGGGAGCTGCAGCATGCTGCAGCAGACCAGCATCAGC

TCCCCTCCAACCTGCAGCGTCAAGTCTCCCCAAGGCTGTGTGGTGGAGAGGCCTCCCAGTAGCAGCCAGCAGCTGGCTCAGTGCAGCATGGCCGCCAATT

TCACCCCACCCATGCAGCTGGCTGACATCCCCGAGACCAGCAATGCCAACATTGGCTTATATGAGCGAATGGGTCAAAGTGATTTTGGGGCTGGGCACTA

CCCACAGCCATCTGCCACCTTCAGCCTTGCCAAACTGCAGCAGTTAACTAATACACTTATTGATCATTCATTGCCTTACAGCCATTCCGCTGCTGTGACC

TCCTATGCAAACAGTGCCTCTTTGTCCACACCATTAAGTAACACAGGGCTTGTTCAGCTTTCGCAGTCTCCACACTCTGTCCCTGGAGGGCCCCAAGCAC

AAGCTACCATGACCCCACCCCCTAACCTGACTCCTCCTCCCATGAATCTGCCACCACCTCTCCTGCAGCGGAACATGGCTGCATCAAATATTGGCATCTC

CCACAGCCAAAGACTGCAAACTCAGATTGCCAGCAAGGGCCACGTCTCCATGAGAACCAAGGCGGCATCTCTGTCACCAGCTGCCGCCACCCATCAGTCA

CAAATCTATGGGCGTTCCCAGACTGTAGCCATGCAGGGTCCTGCACGGACTTTAACGATGCAAAGAGGCATGAACATGAGTGTGAACTTGATGCCAGCGC

CAGCCTACAATGTCAACTCGGTGAACATGAACATGAACACTCTGAATGCCATGAATGGGTATAGCATGTCCCAGCCGATGATGAACAGTGGTTACCACAG

CAACCACGGCTATATGAATCAAACCCCCCAGTACCCTATGCAGATGCAGATGGGCATGATGGGAAGCCAGCCATACGCCCAGCAGCCAATGCAGACCCCA

CCCCACGCTAACATGATGTACACGGCCCCCGGACACCACGGCTACATGAACACAGGCATGTCCAAACAGTCTCTCAATGGGTCCTACATGAGAAGGTAGA

CAGCCTGGCAGCCCACCCAGCCCACTGGGCCCCACTATTGGATTGATCTGCACAAATACCTTTGAAGAGTACGATTTCAAAACCAGCATTGGTGTGAATG

CAAAAACATTTGTTGGCACCATTTATTTAAAAAAAAAAAAGCTGTATGCAGCAGAAAGAAAGCCTTATACAAGTTGTTTTTCTTTTTTCCTTTTTTTCTT

TTTTGGTACCTTTATTTCTGTTACTTTTATATAAAATTCTCTGCAAAGGAAGGCCTCTCTTAGGACTCTAGTTGGCAGCGGCCACACGTCGTGCCTGCTT

CCATTAAACAGTGTGGATACAAGCCCCTCCCCAAATCACCTGTTTTAATACTGAACCTCCAGCTTTTCTCCTTCCTGTCTACTCCATGGAAATGCCTTTA

GCATTTCAATTACTGTATATTTTGTTTAAGGTGACCCTTCAGCATGCCGCTAATGTCTTTGTTAGTGACAGTGCATTTTGTAGTACTGTACAAGTGTTGT

GCTAACGGTAAGCCATTTCTTAAGTTTTTTGCCTTGATTAGGGTACCCTAATTTGAGGGTTAAAAAAAACAAAACAAAACAAAGCTCTATTTTTGTTAAT

TATAAAACTGTAAAGAGCTACAGAGCTATCCCCGTCTGGTTAGTGAAGGGGGTTTATCGCTAAATGTTTGGTGTAAAGTTGAGAAGACCTTTTTCCATTT

TGGTGGCAGGCTCCTTTGGGGGGAGGCAGCTTTCTGTTTTATAAATGCACACTTCTGTTTATTGAATGAAGCATATCTCAGTGTTTATCTGTCAGGTTTT

GAAGCATTTCATATATGTCCAAATACTTGGCAGGATTTAAAAAAAAATAGTGAATTTGGTGTAAAGTTGCTATTTTATGGAAATGCCTCTAACTTTACAT

TTTCATTCCATCTGTAGATTTTTCTATCTTTATAAAATATTGGAGTTATTTTTTAAGGAAAAATAGAAAAGTAGCTTGTGAATAGCTCAAACTAAGCTTA

CAAATCGCATGTAAAAAAGCAGAAAAGTTATTTGTGTCTGTTTCTATTGCGTCCTTTTTTAGCCTTTGTACCTGGACAGGTGACAGTAAGGGCCAAGCAG

GAGAGGCGGGCGCGGCCTTGTATAAAATAGGAGCCAGCGGGACTCTTGTATCTACCTGTTCTCTTTTTAGTCAGTTACTTCAAAAAAAAGAAAAAGCAAA

AACAAAAAAACAAAAGCTGTACATTTTAACATAAAATAAATTATGATGAGCCATTTCT
Translation
 - UNI688 - - UNI11806 - MVKLANPLYTEWILEAVQKIKKQKQRPSEERICHAVSTSHGLDKKTVSEQLELSVQDGSVLKVTNKGLASYKDPD

NPGRFSSVKPGTFPKPTKGSKGPPCNDLRNVDWNKLLKRAIEGLEEPNGSSLKNIEKYLRSQSDLTGTTNHPAFQQRLRLGAKRAVNNGRLLKEGPQYRV

NSGSSDGKGAPQYPSAFPSSLPPVSLLPHEKDQ - UNI3389 - PRADPIPICSFCLGTKESNREKKPEELLSCADCGSSG - UNI16457 - GHP

SCLKFCPELTANVKALRWQCIECKTCSACRVQGKNA - UNI22743 - DNMLFCDSCDRGFHMECCDPPLSRMPKG - UNI9319 - GMWICQVCR

PKKKGRKLLHEKAAQIKRRYAKPIGRPKNKLKQRLL LSVTSDEGSMSAFTGRGSPGRGQKTKVSTTPSSGHAASGKHSSSRLAVTDPTRPGATTKTTTS

STYISASTLKVNKKTKGLIDGLTKFFTPSPDGRRSRGEIIDFSKHYRPRKKVSQKQSCTSHVLATD DTDIKISIKQESADVSLVGNKELVTEEDLDVFK

QAQELSWE KIECESGVEDCGRYPSVIEFGKYEIQTWYSSPYPQEYAR RLPKLYLCEFCLKYMKSKNILLRHSKKCGWFHPPANEIYRRKDLSVFE - 

UNI6010 - VDGNMSKIYCQNLCLLAKLFLDHKTLYYDVEPFLFYVLTKNDEKGCHLVGYFSK - UNI178 - EKLCQQKYNVSCIMIMPQHQRQGF

GRFLIDFS - UNI220 - SYLLSRREGQAGSPEKPLSDLGRLSYLAYWKSVILEYLYRHHERHISIKAISRATGMCPHDIATTLQHLHMIDRRDGR R

FVIIRREKLILGHMEKLKNCSRPNELDPESLRWTPMLISNAVVSEEEREAEKE AERLMEQASCWEKEEQEILSSRVSSRQSSAKVQSKNKYLHSPERRP

VAGERGQLLELSKESSEEEEEEEEEDDEEEEEEEEEESIQTSPPRLTKPQSVSIKRK RPFVVKKKRGRKRRRINSSVTTETISETTEVLNEPFDNSDEE

RPMPQLEPTCEIPVEEGGRKPVLRKAFPHQPGKKRQTEEEEGEDNHFFKTAALCRK KDVDDDAEHLKEGSKDNPEPLKCRQVWPKGAKRGLSKWKQSKE

RKTGFKLNLYTPPETPMEPEDQVTIEEQKELSEDKGSPVGMEREVTETVDALLPQEGSRREETGIPVSPHKSPGGKVDEEDLIRGEEEGEEEGEEEGERE

EQEEEEEVTTEKDLDGAKSKENPEPEISMEKEDPVHLGDHEEDEDEEEEPSHNEDHDADDEDDGHMEAANMERGDLPRETFKDALEGQEAFLDLSIQPSH

SNPEVLMNCGVDLTMSCNSEPKELAGDTGTAPESDAEPPEEQTQKQDQKNSDGVDAELEEGGPAAVEIDSETAQAVQSLTQENREHDDTFPDCAETQEAC

RSLQNYTHTDQSPQIATTLDECQQSDHSSPVSSVHSHPGQSVRSVNSPSVPALENSYAQISPDQTAITVPPLQNMETSPMMDVPSVSDHSQQVVDSGFSD

LGSIESTTENYENPSSYDSTMGGSICGNGSSQNSCSYSSLTSSNLTQNSCAVTQQMSNISGSCSMLQQTSISSPPTCSVKSPQGCVVERPPSSSQQLAQC

SMAANFTPPMQLADIPETSNANIGLYERMGQSDFGAGHYPQPSATFSLAKLQQLTNTLIDHSLPYSHSAAVTSYANSASLSTPLSNTGLVQLSQSPHSVP

GGPQAQATMTPPPNLTPPPMNLPPPLLQRNMAASNIGISHSQRLQTQIASKGHVSMRTKAASLSPAAATHQSQIYGRSQTVAMQGPARTLTMQRGMNMSV

NLMPAPAYNVNSVNMNMNTLNAMNGYSMSQPMMNSGYHSNHGYMNQTPQYPMQMQMGMMGSQPYAQQPMQTPPHANMMYTAPGHHGYMNTGMSKQSLNGS

YMRR

For any suggestions or comments, please send an email to unitrap@crg.es