Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000021786 (Oxsm)
Chromosomal location
Chr 14: 17071173 - 17082322 (-)
Description
3-oxoacyl-ACP synthase, mitochondrial Gene [Source:MGI (curated);Acc:Oxsm-001]
RefSeq_dna
NM_027695 
RefSeq_peptide
NP_081971.1 
UniGene
Mm.399548 Mm.197960 
MGI
MGI:1918397 
Uniprot/SWISSPROT
Q9D404 
Uniprot/SPTREMBL
Q148P2 
Human Ortholog
ENSG00000151093 (KS)
Omim not available
UniTrap UNI16825
Vector Insertion
Chr 14: 17074304 - 17075313
Public Clones not available
Private Clones OST453625 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000112624
Sequence
ACAAGGGGCCGAGCCAGTGGAGTAGATCTCGAGCTGTGGTGGCTGCTTGTGTCGGGTAGGGTCCCAGAGATAATTGCACAGCCTTCTTTTTACGGTAGAT

AAAAGTCTTTTGTGGAAGAAAAGACTCCAGAAGACCGA ATTTATCTCTGAGCAAGTAAAACTTTCGTAAGCTCAGGAATTTCCACTTCAGATATTGGGC

AATCTTCTGGTCACTTCCTGTCATGAGTCAGCCCTTTTTATTGTTACAGAAGTAGCTGTTTACATCATTTGCTAAAGTAAATAAAG - UNI16825 - 

GAATGTGTTTCTGATCTTCTGAATTTCAACCATGTTGTCAAAATGCTTGCAACATTTTCTAAAAGCCACAATCTCCCATCCATATCCAGCGTCATATTCT

TGGTTAATAAGCAAACACAGATTTTATGGAACTGTGCCAGCAGCCATGTTGCGCAGACGAGTTGTCATCACAGGCATTGGCCTAGTGACACCACTTGGCG

TTGGGACTCAACTAGTTTGGGATCGGCTTCTCCGAGGAGAAAGTGGAATTGTTTCTGTGGTTGGTGATGAGTACAAGAATATCCCTTGCAGTGTAGCTGC

TTATGTACCAAGAGGTCCACATGAAGGTCAGTTTAATGAAGAAAACTTTGTGTCCAAATCAGATGCCAAGTCCATGTCTTCTTCCACCATCATGGCTGTT

GGGGCAGCAGAGTTGGCCCTGAAAGACTCCGGCTGGCATCCGAAACGAGAAGCAGATCAGGTGGCTACTGGCGTTGCCATTGGCATGGGCATGGTTCCTC

TTGAAGTTATTTCTGAAACTGCTTTGCTGTTTCAGACCAAAGGTTATAATAAAGTCAGCCCATTCTTTGTCCCTAAGATTCTGATCAATATGGCTGCAGG

CCAGGTTAGCATTCGCTACAAACTCAAGGGCCCCAATCACTCAGTGTCCACAGCCTGCACCACAGGTGCACATGCTGTGGGAGACTCCTTTAGATTCATA

GCCCATGGTGACGCAGATGTGATGGTGGCTGGGGGCACAGACTCTTGCATTAGTCCATTATCTCTCGCTGGGTTTTCCAGAGCCCGGGCTCTGAGCTCAA

ACCCAGATCCTAAGCTAGCCTGCCGGCCGTTTCATCCAGAGAGAGATGGTTTTGTCATGGGTGAGGGAGCTGCTGTGCTGGTGCTGGAAGAACATGAGCA

TGCTGTTCAGAGAGGAGCTCGGATCTACGCAGAAATTTTGGGTTATGGACTCTCGGGTGATGCCGGTCACATAACTGCCCCCGATCCCGAAGGAGAAGGT

GCTTTAAG - UNI16825 - ATGCATGGCTGCTGCTGTAAAAGATGCAGGCGTATCACCTGAGCAGATATCCTATGTCAACGCACATGCCACTTCCAC

ACCACTGGGTGATGCCGCTGAGAACAGAGCCATCAAGAGGCTCTTTAGGGACCATGCTTGTGCCCTTGCCATATCCTCCACAAAGGGAGCCACTGGGCAT

CTTCTGGGTGCTGCAGGGGCAGTTGAGGCAACTTTTACTGCACTGGCTTGTTACCACCAGAAACTCCCACCAACTTTAAACCTGGATTGTACAGAGCCTG

AATTTGATCTCAATTATGTTCCACTGGAGTCACAGGAATGGAAAGCTGAGGGTCGGTGTATTGGACTCACCAATTCCTTTGGGTTTGGTGGTACTAATGC

AACTCTTTGTATTGCTGGCATGTAAACACTGGCTTTTAATGGTCATAAATTTATAAATA
Translation
  - UNI16825 - MLSKCLQHFLKATISHPYPASYSWLISKHRFYGTVPAAMLRRRVVITGIGLVTPLGVGTQLVWDRLLRGESGIVSVVGDEYKNIP

CSVAAYVPRGPHEGQFNEENFVSKSDAKSMSSSTIMAVGAAELALKDSGWHPKREADQVATGVAIGMGMVPLEVISETALLFQTKGYNKVSPFFVPKILI

NMAAGQVSIRYKLKGPNHSVSTACTTGAHAVGDSFRFIAHGDADVMVAGGTDSCISPLSLAGFSRARALSSNPDPKLACRPFHPERDGFVMGEGAAVLVL

EEHEHAVQRGARIYAEILGYGLSGDAGHITAPDPEGEGALR - UNI16825 - RCMAAAVKDAGVSPEQISYVNAHATSTPLGDAAENRAIKRLFRDH

ACALAISSTKGATGHLLGAAGAVEATFTALACYHQKLPPTLNLDCTEPEFDLNYVPLESQEWKAEGRCIGLTNSFGFGGTNATLCIAGM
Transcript ENSMUST00000112625
Sequence
GCGCATGCGCACTCGGTGGGCGCCCGCAAAGGCTTGTTTCAG - UNI16825 - GAATGTGTTTCTGATCTTCTGAATTTCAACCATGTTGTCAAAAT

GCTTGCAACATTTTCTAAAAGCCACAATCTCCCATCCATATCCAGCGTCATATTCTTGGTTAATAAGCAAACACAGATTTTATGGAACTGTGCCAGCAGC

CATGTTGCGCAGACGAGTTGTCATCACAGGCATTGGCCTAGTGACACCACTTGGCGTTGGGACTCAACTAGTTTGGGATCGGCTTCTCCGAGGAGAAAGT

GGAATTGTTTCTGTGGTTGGTGATGAGTACAAGAATATCCCTTGCAGTGTAGCTGCTTATGTACCAAGAGGTCCACATGAAGGTCAGTTTAATGAAGAAA

ACTTTGTGTCCAAATCAGATGCCAAGTCCATGTCTTCTTCCACCATCATGGCTGTTGGGGCAGCAGAGTTGGCCCTGAAAGACTCCGGCTGGCATCCGAA

ACGAGAAGCAGATCAGGTGGCTACTGGCGTTGCCATTGGCATGGGCATGGTTCCTCTTGAAGTTATTTCTGAAACTGCTTTGCTGTTTCAGACCAAAGGT

TATAATAAAGTCAGCCCATTCTTTGTCCCTAAGATTCTGATCAATATGGCTGCAGGCCAGGTTAGCATTCGCTACAAACTCAAGGGCCCCAATCACTCAG

TGTCCACAGCCTGCACCACAGGTGCACATGCTGTGGGAGACTCCTTTAGATTCATAGCCCATGGTGACGCAGATGTGATGGTGGCTGGGGGCACAGACTC

TTGCATTAGTCCATTATCTCTCGCTGGGTTTTCCAGAGCCCGGGCTCTGAGCTCAAACCCAGATCCTAAGCTAGCCTGCCGGCCGTTTCATCCAGAGAGA

GATGGTTTTGTCATGGGTGAGGGAGCTGCTGTGCTGGTGCTGGAAGAACATGAGCATGCTGTTCAGAGAGGAGCTCGGATCTACGCAGAAATTTTGGGTT

ATGGACTCTCGGGTGATGCCGGTCACATAACTGCCCCCGATCCCGAAGGAGAAGGTGCTTTAAG - UNI16825 - ATGCATGGCTGCTGCTGTAAAA

GATGCAGGCGTATCACCTGAGCAGATATCCTATGTCAACGCACATGCCACTTCCACACCACTGGGTGATGCCGCTGAGAACAGAGCCATCAAGAGGCTCT

TTAGGGACCATGCTTGTGCCCTTGCCATATCCTCCACAAAGGGAGCCACTGGGCATCTTCTGGGTGCTGCAGGGGCAGTTGAGGCAACTTTTACTGCACT

GGCTTGTTACCACCAGAAACTCCCACCAACTTTAAACCTGGATTGTACAGAGCCTGAATTTGATCTCAATTATGTTCCACTGGAGTCACAGGAATGGAAA

GCTGAGGGTCGGTGTATTGGACTCACCAATTCCTTTGGGTTTGGTGGTACTAATGCAACTCTTTGTATTGCTGGCATGTAAACACTGGCTTTTAATGGTC

ATAAATTTATAAATATTATATATGTAGATATGTCTTATATCAATATCCAATGACTTTAGCACAATTGGTATTTGTATAGTTCTTTGGTAGGGAACAGGGT

GCCCAGTACTTGTTATTTTATAGCATCTTGGTGTCTCCATTGAGATTTCAGTGGCAACTAGTGACAACCAGAAATGTCTATGGAGGACAGAATAACCTGC

ACACAGAACCATTGATTTATGTTTTTCTAGTGCACGATTTCATCCATCATGGTCCTTTTCAGATATTTATTTAGAGACCAGCTTCTCTGAGCAAGGCTGT

GCTGCTCCATGGTGTAACTAACTCTAGGGTCACCACTGTTGTACAGCATATAAACAGGACTACAATACAAGTACTCCTATTTGTATCACCACTCAGCATC

CCTTTAGGACAGCTGTCAGCCAGTGATTCACCCCTGACCCATGTAGTGTCCTTGGTGGAATTTCCCCAAGCTCCCAAGATTTCAGTTCTCTGAAGGAGGA

AGTAAAACAGGATTTCCTTTTTCTTGCCTGTTCTTGACCGACCTCCCTCCCTTCCTTCCTTCCTTTCTTTCCTTCCTTTCTTCGTCATCTTTTTTTCGCC

TTCTTTGAGACATGGTTACTCAGGTAACCCTAGCTGTCTTGGAACTCACTCTATAGACCCTGGCTGACCTTGATCTCTATAGGGATTTGCCTGCCTCTGC

CTCCTAAGTGCTGCAATTAAAGGTGTACACCAGC
Translation
 - UNI16825 - MLSKCLQHFLKATISHPYPASYSWLISKHRFYGTVPAAMLRRRVVITGIGLVTPLGVGTQLVWDRLLRGESGIVSVVGDEYKNIPC

SVAAYVPRGPHEGQFNEENFVSKSDAKSMSSSTIMAVGAAELALKDSGWHPKREADQVATGVAIGMGMVPLEVISETALLFQTKGYNKVSPFFVPKILIN

MAAGQVSIRYKLKGPNHSVSTACTTGAHAVGDSFRFIAHGDADVMVAGGTDSCISPLSLAGFSRARALSSNPDPKLACRPFHPERDGFVMGEGAAVLVLE

EHEHAVQRGARIYAEILGYGLSGDAGHITAPDPEGEGALR - UNI16825 - RCMAAAVKDAGVSPEQISYVNAHATSTPLGDAAENRAIKRLFRDHA

CALAISSTKGATGHLLGAAGAVEATFTALACYHQKLPPTLNLDCTEPEFDLNYVPLESQEWKAEGRCIGLTNSFGFGGTNATLCIAGM
Transcript ENSMUST00000022311
Sequence
GCGGCCATGGGAGGTGCTGACTCAAACTCCCAGCCAGTTGTGGAAAGTGCTGCACTCAGTACAAAGGTGACTTGACACAAAGTTCGTAACTTAAACTATA

AATGTGTCAACCGCCAAACTCGGCGTGAACGTTTAACTGGCACTCGGGCTGAGCCACAGCGCCGGGATCCTGCAGCGAGATGGGACAGCACAGCTGTCAA

ACTCAGTGACAGCCTCGGCGGGCCCTCGTCGCCCAGCCCGCCCCGCCTCAGGCCCGAGTGTCCGCGGCCCCGCCCGCCTGCGGCCCTCAGGCTCGAGGGC

CCCGGCTGCACCTCAGGATGTTGTCGGCGTAG - UNI16825 - GAATGTGTTTCTGATCTTCTGAATTTCAACCATGTTGTCAAAATGCTTGCAACA

TTTTCTAAAAGCCACAATCTCCCATCCATATCCAGCGTCATATTCTTGGTTAATAAGCAAACACAGATTTTATGGAACTGTGCCAGCAGCCATGTTGCGC

AGACGAGTTGTCATCACAGGCATTGGCCTAGTGACACCACTTGGCGTTGGGACTCAACTAGTTTGGGATCGGCTTCTCCGAGGAGAAAGTGGAATTGTTT

CTGTGGTTGGTGATGAGTACAAGAATATCCCTTGCAGTGTAGCTGCTTATGTACCAAGAGGTCCACATGAAGGTCAGTTTAATGAAGAAAACTTTGTGTC

CAAATCAGATGCCAAGTCCATGTCTTCTTCCACCATCATGGCTGTTGGGGCAGCAGAGTTGGCCCTGAAAGACTCCGGCTGGCATCCGAAACGAGAAGCA

GATCAGGTGGCTACTGGCGTTGCCATTGGCATGGGCATGGTTCCTCTTGAAGTTATTTCTGAAACTGCTTTGCTGTTTCAGACCAAAGGTTATAATAAAG

TCAGCCCATTCTTTGTCCCTAAGATTCTGATCAATATGGCTGCAGGCCAGGTTAGCATTCGCTACAAACTCAAGGGCCCCAATCACTCAGTGTCCACAGC

CTGCACCACAGGTGCACATGCTGTGGGAGACTCCTTTAGATTCATAGCCCATGGTGACGCAGATGTGATGGTGGCTGGGGGCACAGACTCTTGCATTAGT

CCATTATCTCTCGCTGGGTTTTCCAGAGCCCGGGCTCTGAGCTCAAACCCAGATCCTAAGCTAGCCTGCCGGCCGTTTCATCCAGAGAGAGATGGTTTTG

TCATGGGTGAGGGAGCTGCTGTGCTGGTGCTGGAAGAACATGAGCATGCTGTTCAGAGAGGAGCTCGGATCTACGCAGAAATTTTGGGTTATGGACTCTC

GGGTGATGCCGGTCACATAACTGCCCCCGATCCCGAAGGAGAAGGTGCTTTAAG - UNI16825 - ATGCATGGCTGCTGCTGTAAAAGATGCAGGCG

TATCACCTGAGCAGATATCCTATGTCAACGCACATGCCACTTCCACACCACTGGGTGATGCCGCTGAGAACAGAGCCATCAAGAGGCTCTTTAGGGACCA

TGCTTGTGCCCTTGCCATATCCTCCACAAAGGGAGCCACTGGGCATCTTCTGGGTGCTGCAGGGGCAGTTGAGGCAACTTTTACTGCACTGGCTTGTTAC

CACCAGAAACTCCCACCAACTTTAAACCTGGATTGTACAGAGCCTGAATTTGATCTCAATTATGTTCCACTGGAGTCACAGGAATGGAAAGCTGAGGGTC

GGTGTATTGGACTCACCAATTCCTTTGGGTTTGGTGGTACTAATGCAACTCTTTGTATTGCTGGCATGTAAACACTGGCTTTTAATGGTCATAAATTTAT

AAATATTATATATGTAGATATGTCTTATATCAATATCCAATGACTTTAGCACAATTGGTATTTGTATAGTTCTTTGGTAGGGAACAGGGTGCCCAGTACT

TGTTATTTTATAGCATCTTGGTGTCTCCATTGAGATTTCAGTGGCAACTAGTGACAACCAGAAATGTCTATGGAGGACAGAATAACCTGCACACAGAACC

ATTGATTTATGTTTTTCTAGTGCACGATTTCATCCATCATGGTCCTTTTCAGATATTTATTTAGAGACCAGCTTCTCTGAGCAAGGCTGTGCTGCTCCAT

GGTGTAACTAACTCTAGGGTCACCACTGTTGTACAGCATATAAACAGGACTACAATACAAGTACTCCTATTTGTATCACCACTCAGCATCCCTTTAGGAC

AGCTGTCAGCCAGTGATTCACCCCTGACCCATGTAGTGTCCTTGGTGGAATTTCCCCAAGCTCCCAAGATTTCAGTTCTCTGAAGGAGGAAGTAAAACAG

GATTTCCTTTTTCTTGCCTGTTCTTGACCGACCTCCCTCCCTTCCTTCCTTCCTTTCTTTCCTTCCTTTCTTCGTCATCTTTTTTTCGCCTTCTTTGAGA

CATGGTTACTCAGGTAACCCTAGCTGTCTTGGAACTCACTCTATAGACCCTGGCTGACCTTGATCTCTATAGGGATTTGCCTGCCTCTGCCTCCTAAGTG

CTGCAATTAAAGGTGTACACCAGCATAGCCTGGCTGGTTTGGCTTTTCTCATTCTAGATATGTTTGTGATGTGGTGAATGGACATAAAGATCTTTGGAAA

AAACTCTTGTTAAGTTAGGCCAGCTCCTCTCTAACTTCTAACTTTGTGACTGTGACAATGTTCTCCAAGCTTCCTACTACTAGGGTAGCAAGTTCTTCAG

AGGTGACAGCCATCCAGGAAAGCATTTGGTAGGCAGGGCTTTTATCTCTTCTGAGTAAGTGTTTTCATGTCTATGCAGGTCCACAATGATATGGAGCTTC

AGTCAAGTGCCTACATTTCCTGGGCTCAGTAACACCTTTAATGGCTTTCTGTCCTTGTACTGTTTAATGATTTTTATTCCAATTCCATGACAAACTGCCT

TTTGGCCTCTGCTTTCTTAGTGGCACACACACACACACACACACACACACACACACACACACACACAGTGTGAGAGAAAGGGAGATAGTAAAAAAGGAGA

TAAATGGCTATATGCCTATGTGCCTTTCTGCAGAATGGGGAGCAGTCTCACATTTTACTTAAAACTTTTTGTTCTTGTTTTAGTTTTTTTAAAAAAATAA

TGTGTATGAGTGTTTTCCCTGAGGAGCAGAAGATGGCCTAGTCAGCCATCATTGGGAAAGAAAGGCCCCTTGGTCGTGCAAACTTTATATGCCTCAGTAT

GGGGGAATGCTAAGGCCAAGAAGTGGGAGTGGGTGGGTAGGGGAGTGGGGGAGGAGGGTATGGGGGACTTTTGGGATAGCATTGGAAATGTAAATGAAGA

AAATACCTAATTAAAAAAAGAGCTAAAAAAAAGGCAAAAACAATGAGAGGATTGTTGTGTATACTGTACATGCATCCTTGGGAAGAGCACTAGCTAATAA

TGCAATCAGCACATACAATGGTGAGCCTCTCCCTACGGTAAATGTCATTTAAACATTGTCAACAATTATATCTCCTTTCAAAACTGTTGCCTGTAAAATG

ATTGAAAAGCACTAAGTAGACTATATCAGAATGGGAATGAAATCTAGACAGTGTGATTCTTTTCAAGCTGTGGTCACACAGTTAAGGGGAAACAAAGCTG

GGAAAGAAAAATTATTAATTTTAAAATTCACTATTTGAATGTAACAATATTGTATGAACTCAAAAATGTACTTTAAAAGGAAGAAATTGTTTTTAATGTG

TAATTCATGGTTGGTGAATGAAATTTTTATTTTTGGTACAATAATATAAATGAAAATAAAAATGTTGTAAGATAAACAAC
Translation
 - UNI16825 - MLSKCLQHFLKATISHPYPASYSWLISKHRFYGTVPAAMLRRRVVITGIGLVTPLGVGTQLVWDRLLRGESGIVSVVGDEYKNIPC

SVAAYVPRGPHEGQFNEENFVSKSDAKSMSSSTIMAVGAAELALKDSGWHPKREADQVATGVAIGMGMVPLEVISETALLFQTKGYNKVSPFFVPKILIN

MAAGQVSIRYKLKGPNHSVSTACTTGAHAVGDSFRFIAHGDADVMVAGGTDSCISPLSLAGFSRARALSSNPDPKLACRPFHPERDGFVMGEGAAVLVLE

EHEHAVQRGARIYAEILGYGLSGDAGHITAPDPEGEGALR - UNI16825 - RCMAAAVKDAGVSPEQISYVNAHATSTPLGDAAENRAIKRLFRDHA

CALAISSTKGATGHLLGAAGAVEATFTALACYHQKLPPTLNLDCTEPEFDLNYVPLESQEWKAEGRCIGLTNSFGFGGTNATLCIAGM

For any suggestions or comments, please send an email to unitrap@crg.es