Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000021798 (Ldb3)
Chromosomal location
Chr 14: 35339885 - 35401867 (-)
Description
LIM domain binding 3 Gene [Source:MGI Symbol;Acc:MGI:1344412]
RefSeq_dna
NM_001039076 NM_001039074 NM_001039071 NM_001039072 NM_011918 
RefSeq_peptide
NP_001034165.1 NP_001034163.1 NP_001034160.1 NP_001034161.1 NP_036048.3 
UniGene
Mm.29733 
MGI
MGI:1344412 
Uniprot/SWISSPROT
Q9JKS4 
Uniprot/SPTREMBL
Q3TRD4 B2RSB0 
Human Ortholog
ENSG00000122367 (LDB3)
Omim 601493 - CARDIOMYOPATHY, DILATED, 1C  609452 - MYOPATHY, MYOFIBRILLAR, ZASP-RELATED  
UniTrap UNI35722
Vector Insertion
Chr 14: 35357158 - 35365509
Public Clones IST14983G3 (tigm) IST13136D6 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 54% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI37279
Vector Insertion
Chr 14: 35355794 - 35357158
Public Clones CMHD-GT_461C11-3 (cmhd)
Private Clones not available
Severity of mutation (?) Insertion after 76% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI31167
Vector Insertion
Chr 14: 35349750 - 35355175
Public Clones IST13846B2 (tigm) IST13351D4 (tigm) IST14605D4 (tigm) IST13405B2 (tigm)
IST13075A8 (tigm) IST10258A2 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 90% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI19103
Vector Insertion
Chr 14: 35342736 - 35349750
Public Clones not available
Private Clones OST404613 (lexicon) OST329288 (lexicon)
Severity of mutation (?) Insertion after 96% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000022330
Sequence
CGATGGCATTCACTCCCAGCTATTCTTAGGAGCCTCCCAGGAGCTCTGCACAGCCTGGCCAGGCAGCAAGGAACGCAGCAG AGGAAGCCACCGCTGTCA

GCACCAGTATGTCTTACAGTGTGACTCTGACTGGGCCTGGGCCCTGGGGCTTCCGTCTGCAGGGAGGCAAGGACTTCAACATGCCCCTCACTATCTCCCG

G ATCACTCCAGGCAGCAAGGCAGCCCAGTCCCAGCTCAGCCAAGGAGACCTGGTGGTGGCCATTGATGGCGTCAACACAGACACCATGACCCACCTGGA

GGCCCAGAACAAGATCAAGTCGGCCAGCTACAACCTGAGCCTCACTCTACAGAA GTCCAAGCGGCCTATTCCCATCTCCACGACAGCGCCTCCCATCCA

GTCCCCGCTGCCAGTGATCCCCCACCAGAAG GACCCTGCTCTGGACACGAACGGCAGCCTGGCGACTCCCAGCCCCAGCCCTGAGGCAAGGGCCAGCCC

AGGCGCCCTGGAGTTCGGGGACACCTTTAGCTCCTCCTTCTCCCAGACCTCTGTCTGCAGCCCACTCATGGAGGCCTCGGGGCCTGTCCTTCCTCTGGGT

AGCCCAGTGGCCAAGGCCAGCTCAGAGGGTGCACAGGGCTCAGTCAGCCCCAAAGTTCTGCCAGGCCCCAGCCAACCGAGGCAATATAACAACCCCATTG

GCCTGTACTCAGCAGAGACCCTGAGGGAGATGGCTCAGATGTATCAGATGAGCCTCCGAGGGAAGGCCTCAGGTGCTGGACTCCTAGGAGG GAGCCTCC

CTGTGAAAGACTTGGCGGTGGACAGCGCCTCTCCTGTGTACCAGGCTGTGATCAAAACCCAAAGCAAGCCGGAAGATGAGGCTGATGAGTGGGCCCGCCG

GTCCTCCAACCTGCAGTCTCGCTCCTTCCGCATCCTGGCCCAGATGACCGGGACAGAATACA TGCAAGACCCTGATGAAGAGGCTCTGCGAAGGTCAAG

 GGAAAGGTTTGAAACGGAACGTAACAGCCCACGTTTTGCCAAATTGCGCAACTGGCACCACGGCCTTTCAGCCCAAATCCTTAATGTTAAAAGCTAAAA

GGCTGCTTGGATTCCCCTGAACCCTGGCAGGCTGGACCCCCGCCCCTCTCCCACACAGATCTGGCATGTGAACCCCATGGTGATGCTTGATAATGAACGC

TGTGCTGGGGGCACCTCTGGTAGACAACTGTAGCACTCCTGCTCTCTGCCCACCCCAGAGCTGACAGCTGAGGCCCAGTACTTCCTACCTCTCCAACCCC

CAATCCAGGGTGACCATCCCAACTCCCACAAGTGGAGTCTCTGTACACCCCCTCATGCAAACCCTTAGCTGTAGTCCAGAGAGGACATAACAGGGCTTGC

TGGCCTAACACTGCCAAACAATGAAAACATAGTGGCCACTGCTCATTTGCCCACCCCTTCTGGCATCTGGACTCACAGTCACCTGGAACACATTACGAGC

AGATCAGGCCCCTGGGTGGGCACCCTCTTCTCTATACTTGTGTGCTGGCTTCATAGTTCTTTCTCATGTACATACAAGCATGCTTGTTTTGAAATAAAGA

GGATTTGAAATGAACAAACCAAGCCCCAAA
Translation
 MSYSVTLTGPGPWGFRLQGGKDFNMPLTISR ITPGSKAAQSQLSQGDLVVAIDGVNTDTMTHLEAQNKIKSASYNLSLTLQK KSKRPIPISTTAPPI

QSPLPVIPHQK DPALDTNGSLATPSPSPEARASPGALEFGDTFSSSFSQTSVCSPLMEASGPVLPLGSPVAKASSEGAQGSVSPKVLPGPSQPRQYNNP

IGLYSAETLREMAQMYQMSLRGKASGAGLLGG GSLPVKDLAVDSASPVYQAVIKTQSKPEDEADEWARRSSNLQSRSFRILAQMTGTEYM MQDPDEEA

LRRSR RERFETERNSPRFAKLRNWHHGLSAQILNVKS
Transcript ENSMUST00000090040
Sequence
GCAGCAGGCAAGGCCAGGGGTTGGGGTCTGGGGCCAGGACCAGAGATAGGGGCTGGGAAGATAGGCTGCATAAGGGTCCTCTCACCTGACTCTTCGTACT

GTTTGCCTGCAGAGGAAGCCACCGCTGTCAGCACCAGTATGTCTTACAGTGTGACTCTGACTGGGCCTGGGCCCTGGGGCTTCCGTCTGCAGGGAGGCAA

GGACTTCAACATGCCCCTCACTATCTCCCGG ATCACTCCAGGCAGCAAGGCAGCCCAGTCCCAGCTCAGCCAAGGAGACCTGGTGGTGGCCATTGATGG

CGTCAACACAGACACCATGACCCACCTGGAGGCCCAGAACAAGATCAAGTCGGCCAGCTACAACCTGAGCCTCACTCTACAGAA GTCCAAGCGGCCTAT

TCCCATCTCCACGACAGCGCCTCCCATCCAGTCCCCGCTGCCAGTGATCCCCCACCAGAAG GTGGTAGCCAATTCTCCAGCCAA TGCTGACTACCAGG

AACGCTTCAACCCCAGCGTCCTGAAGGACTCAGCCCTGTCCACCCACAAGCCCATTGAAGTGAAGGGCTTGGGAGGCAAGGCCACTATCATCCACGCTCA

GTACAACACCCCGATCAGCATGTACTCACAGGATGCTATCATGGACGCCATCGCGGGGCAGGCCCAGGCCCAGGGCAGTGACTTCAGTGG GGCGTCTCC

GCTGGC GAGCCTCCCTGTGAAAGACTTGGCGGTGGACAGCGCCTCTCCTGTGTACCAGGCTGTGATCAAAACCCAAAGCAAGCCGGAAGATGAGGCTGA

TGAGTGGGCCCGCCGGTCCTCCAACCTGCAGTCTCGCTCCTTCCGCATCCTGGCCCAGATGACCGGGACAGAATACA TGCAAGACCCTGATGAAGAGGC

TCTGCGAAGGTCAAG CACCCCTATTGAGCATGCTCCAGTGTGCACCAGCCAGGCCACTTCCCCGCTGCTGCCTGCTTCTGCCCAGTCGCCCGCTGCTGC

CTCTCCCATTGCGGCCTCGCCAACCCTGGCCACAGCTGCTGCCACCCATGCTGCTGCCGCCTCTGCTGCAGGCCCTGCCGCAAGTCCCGTGGAGAATCCG

AG - UNI35722 - GCCACAGGCCTCTGCTTACAGTCCTGCAGCCGCCGCTTCTCCAGCACCCTCTGCCCATACCAGCTACAGCGAGGGTCCAGCTGC

CCCTGCACCCAAGCCTCGGGTCGTAACCACTGCCAGCATCCGGCCTTCTGTCTACCAGCCAG - UNI35722 - TGCCTGCATCTTCCTACAGCCCAT

CTCCAGGAGCCAATTACAGTCCAACTCCCTATACCCCTTCGCCAGCTCCTGCTTATACCCCCTCTCCTGCTCCCACCTATACCCCCTCACCTGCACCTAC

ATACTCCCCTTCCCCTGCACCAGCTTATACCCCCTCACCTGCCCCAAACTATACCCCTACACCATCAGCTGCCTACAGTGGGGGCCCTTCAGAATCTGCC

AGCCGTCCACCCTGGGTGACCGATGACAGCTTCTCTCAGAAGTTTGCTCCTGGAAAGAGCACTACCACTGTCAGCAAGCAGACCCTGCCCCGGGGGGCTC

CAGCCTACAACCCAACAGGTCCACAAGTGACACCTCTTGCCAGGGGCACCTTCCAGAGAGCTGAGCGCTTCCCAGCTAGCAGCCGGACTCCCCTCTGTGG

GCACTGTAACAATGTCATCAG - UNI35722 - GGGCCCTTTTCTGGTGGCCATGGGCCGCTCTTGGCACCCAGAAGAGTTCAATTGTGCCTACTGCA

AGACCTCCCTAGCAGATGTGTGCTTTGTGGAGGAGCAGAACAACGTTTACTGCGAGCGGTGTTACGAGCAGTTCTTTGCCCCGATCTGTGCCAAATGTAA

CACCAAAATCATGGGG - UNI31167 - GAAGTGATGCACGCTCTGCGACAGACATGGCACACCACCTGCTTTGTCTGTGCAGCCTGCAAGAAGCCCT

TTGGGAACAGCCTCTTCCACATGGAGGATGGAGAGCCATACTGTGAGAAAG - UNI31167 - ACTACATCAACCTGTTCAGCACCAAGTGCCATGGA

TGCGATTTCCCTGTGGAAGCTGGTGACAAGTTTATCGAGGCCCTGGGGCACACCTGGCATGACACCTGCTTCATTTGTGCG - UNI19103 - - UNI

31167 - GTCTGCCACGTGAATCTGGAGGGTCAGCCATTCTACTCTAAGAAAGACAAACCACTGTGCAAGAAGCACGCACATGCCATCAACGTGTAGGA

GCCCAGAGTGGCTGGTGTGCCAAGCCCAGGCTGCTCCTGCTACTGATGACGAAGGAGTCAAAGAAGCTGATGTTGTTTCTTCTGGGAGGGAAGGGGAACG

AGAGAAAATGGTTGAGCCCTTTTGAAGTCTAACTTTAGTCTTTTCTTGTATACACAGATTGTGTATTATTGTAGTTCAGACTAGAAGCCAAAAGAAGATT

CTAAACCCAGCTAGTAATTAATCCACGGCTGGAATTGGACTTCAGGTTTTGGGGAAATGACTCCAAGAAATCAACAGTGAAAAACAAACAAAAAAACAAT

GTTAAAAAATCAAAGACTCCCTAGCCATGTCTGTTGCCAGTGTGGGGACAGAGCCCTGGGCAGTTATGGAGGATCTAAAGTGTGCAGCGGAGCTCTGGAG

CGATCCTTGGCAAGCACAACGATGTGCCAAGCAGTGTTTGCTGTGCGGATATTTTTAGAGCCGGCACTGAGAGCTCCTTAGCTAAGACCCATTGGGCTTT

CCTCACCAAAAAAGGAAGAGTTGTTCCATTAGCATCACAGAGTTACCTCTGCACATCAGACTTCAGATGTTGAACAAACTTGAAACATATAAGGGGAGCC

CAGGCGTCTGAGGCAATGGCGGGCCACCACTGGGCAAGTGAAAAGGCTCCGGGGAGGTCTTTCGCTCACGCCACGGACAGGGGAGAAAAGATGAGCTTTC

TCTGCATCTCCCCCTCTTTCCCTCTGAAATATCTAAAGTCCCTGGAAGGCTTTGCTCCTTTATGAATTGTTAAGGGAAAGTGAAATTGGGTTTCTCCAGT

TTTGCTTTACAATGTATGAGAAGAGGTTTGAAAAGGACTCTGGGTGGGGTTTTAGCCTTTGTTTTGCTTTAAGAGGGTTCTGAGAGGGAGTGTTCTGTGC

ACGTATTTCACCCCCTACCCGCAACAGCTCACGAACATCTTCCTCAGCCCCACCCTCAAATAGGCTCAGTGGGAAAAAGAGAGACAGCATCAAACAGGAT

GCTAGAACGGGCTCCCGGGAGCACCTGCGCACATGCTCATGGAGAGAGGATGCTCTGCTAACCTCAGGAAGAATGCATGGGCTGCAGGACCTCCCATCTC

CAGAGCTGCACCATCCCCTTAACCTGTTCCTTTAAGTGCAGCACAGGAAGTATATACTCATGCTGACTGCTGCAAGGAGGAAAAGCTGCATTTGCCATTT

GGGCCAATATTTGAAAATAGTTGACTGGCTTTAGAATATTTATTGAAATAGACCTGGCCTTCAGACTCTATAACAATACAGGTGACTCTTTTACATATAC

ATGGAATTAGGTGAGCTTGGTAAAGCTATTTAGAAGTAAAGAAAGTGGCTTCCCTTTTGGGTTTCGAGATGGTGCAATCACCTTCCTTTCTAGGAAGTGC

TGTTAGGAAGGATGTTCATTGAAAATGGTATTGAAGCAGGTTGTGTGTATGTGTGTGTGTGTATGTGTGTGTTTCTCACTGGAGCACAGTATGTAGGCAC

TGTACCAACCACTGCCCTTCTCTCCTCCAACCTGTTTTGGATTTTCCACTTTGCACGGTTGAAATGTTTTATAGGTATGCATTCACACTTTTCTTCTTTT

GAGAACTAAGACTTCCAAGAGAGCATCCTCCTACTTACCGGTCTCTCCTCCCTGGAAGACTCTGAATTAGTTAGACATTGTGTAGTAGGAAGTCCATAGT

TAGTTTGGAATCACCAATTCCGCCCAGGCAGCACCAGGGAAGGTCAGAACTATGCTCCTCCAAACAGCTCTTCTTTACTTTTTATGCAAAGCTCCTGGCT

GAGTGCATTCTGCTGGGACAGCTCAGAGGTTTGTCCAGACATGCAGAACAGTACCTTGTGTAGTCTGTTATTTTTGGAAATTTCAGATATTCAGGGACAA

GGAGCTTGCTGACTAAACAGAAGGCTTCTAAGCAGTTGATTTTTTTTTTAATCTATTAAATGATTGGGAACTGATCTTGAGGAAGGGAAATAAAAACCCC

TGCCATTACATTTCCAAAATGTCTTTTTAAAGGTTTTATACATGATCCCAGACACTGCTCCTGTGTAATCATTATCCTTTGTTGTAGGATCCTTAAGAAG

ATAATCAAAATATCCTAAAGGAAAGCATCACCATTCTCCTATGTTAAGTAATTTAAAACAAATATTTAATAGCTTACATGTATTTTTAAGTGACTCTTAT

TTTTTAAATACAAAACAACATTTAGAGGCTGGGTGTAATTCAGTGGTACAGAATTGTCCTAGAATTTAGGATTCTCTAGCTTTGGTCCCCAGCACTGCCA

AAAACCAATATAAAGGTAGCAGAGAAGAAGCCAGTTTCAAGAATGGTCCACAGGGTGAGCATGCATAGTGTTAAGATTAAGGCTGAATGTCGATAGGTTA

CCATCACATCTTTACTAGTGCATAGGAGGAATACAGTGTGTCTTGTTTTCTTATTCTTGGCATTAATCTAATATACTGATAAACACTCACCTTCTGAGTA

GAATGGCTTGTATTGGCAGTGTTTGTGTTAGCAATCTAGCCTTTGTAATGTGAACTTTCAACCCTAGCATTCTTGCTTTGGGGTCTTCTTCCTTTCTTTT

TGGTAAGTTTTCTGAAGTTGGAATATAGTGTGTTAGAGGTGTGTGTAAAACTATTTTGCATGGTTTTCTTTTCCTTTATTTTCCTTTTCTTTCTTTTTGG

TCCGTGTGGATTCTTTTTAGCAAAATAAAATTCAGAAAAAAAAAAGATATACAAATGGC
Translation
MSYSVTLTGPGPWGFRLQGGKDFNMPLTISR ITPGSKAAQSQLSQGDLVVAIDGVNTDTMTHLEAQNKIKSASYNLSLTLQK KSKRPIPISTTAPPIQ

SPLPVIPHQK VVANSPAN NADYQERFNPSVLKDSALSTHKPIEVKGLGGKATIIHAQYNTPISMYSQDAIMDAIAGQAQAQGSDFSG GASPLA ASL

PVKDLAVDSASPVYQAVIKTQSKPEDEADEWARRSSNLQSRSFRILAQMTGTEYM MQDPDEEALRRSS STPIEHAPVCTSQATSPLLPASAQSPAAAS

PIAASPTLATAAATHAAAASAAGPAASPVENPR - UNI35722 - RPQASAYSPAAAASPAPSAHTSYSEGPAAPAPKPRVVTTASIRPSVYQPV - 

UNI35722 - VPASSYSPSPGANYSPTPYTPSPAPAYTPSPAPTYTPSPAPTYSPSPAPAYTPSPAPNYTPTPSAAYSGGPSESASRPPWVTDDSFSQK

FAPGKSTTTVSKQTLPRGAPAYNPTGPQVTPLARGTFQRAERFPASSRTPLCGHCNNVIR - UNI35722 - RGPFLVAMGRSWHPEEFNCAYCKTSL

ADVCFVEEQNNVYCERCYEQFFAPICAKCNTKIMG - UNI31167 - EVMHALRQTWHTTCFVCAACKKPFGNSLFHMEDGEPYCEKD - UNI3116

7 - DYINLFSTKCHGCDFPVEAGDKFIEALGHTWHDTCFICA - UNI19103 - - UNI31167 - VCHVNLEGQPFYSKKDKPLCKKHAHAINV
Transcript ENSMUST00000022328
Sequence
CGATGGCATTCACTCCCAGCTATTCTTAGGAGCCTCCCAGGAGCTCTGCACAGCCTGGCCAGGCAGCAAGGAACGCAGCAG AGGAAGCCACCGCTGTCA

GCACCAGTATGTCTTACAGTGTGACTCTGACTGGGCCTGGGCCCTGGGGCTTCCGTCTGCAGGGAGGCAAGGACTTCAACATGCCCCTCACTATCTCCCG

G ATCACTCCAGGCAGCAAGGCAGCCCAGTCCCAGCTCAGCCAAGGAGACCTGGTGGTGGCCATTGATGGCGTCAACACAGACACCATGACCCACCTGGA

GGCCCAGAACAAGATCAAGTCGGCCAGCTACAACCTGAGCCTCACTCTACAGAA GTCCAAGCGGCCTATTCCCATCTCCACGACAGCGCCTCCCATCCA

GTCCCCGCTGCCAGTGATCCCCCACCAGAAG GACCCTGCTCTGGACACGAACGGCAGCCTGGCGACTCCCAGCCCCAGCCCTGAGGCAAGGGCCAGCCC

AGGCGCCCTGGAGTTCGGGGACACCTTTAGCTCCTCCTTCTCCCAGACCTCTGTCTGCAGCCCACTCATGGAGGCCTCGGGGCCTGTCCTTCCTCTGGGT

AGCCCAGTGGCCAAGGCCAGCTCAGAGGGTGCACAGGGCTCAGTCAGCCCCAAAGTTCTGCCAGGCCCCAGCCAACCGAGGCAATATAACAACCCCATTG

GCCTGTACTCAGCAGAGACCCTGAGGGAGATGGCTCAGATGTATCAGATGAGCCTCCGAGGGAAGGCCTCAGGTGCTGGACTCCTAGGAGG GAGCCTCC

CTGTGAAAGACTTGGCGGTGGACAGCGCCTCTCCTGTGTACCAGGCTGTGATCAAAACCCAAAGCAAGCCGGAAGATGAGGCTGATGAGTGGGCCCGCCG

GTCCTCCAACCTGCAGTCTCGCTCCTTCCGCATCCTGGCCCAGATGACCGGGACAGAATACA TGCAAGACCCTGATGAAGAGGCTCTGCGAAGGTCAAG

 - UNI35722 - GCCACAGGCCTCTGCTTACAGTCCTGCAGCCGCCGCTTCTCCAGCACCCTCTGCCCATACCAGCTACAGCGAGGGTCCAGCTGCCC

CTGCACCCAAGCCTCGGGTCGTAACCACTGCCAGCATCCGGCCTTCTGTCTACCAGCCAG - UNI35722 - TGCCTGCATCTTCCTACAGCCCATCT

CCAGGAGCCAATTACAGTCCAACTCCCTATACCCCTTCGCCAGCTCCTGCTTATACCCCCTCTCCTGCTCCCACCTATACCCCCTCACCTGCACCTACAT

ACTCCCCTTCCCCTGCACCAGCTTATACCCCCTCACCTGCCCCAAACTATACCCCTACACCATCAGCTGCCTACAGTGGGGGCCCTTCAGAATCTGCCAG

CCGTCCACCCTGGGTGACCGATGACAGCTTCTCTCAGAAGTTTGCTCCTGGAAAGAGCACTACCACTGTCAGCAAGCAGACCCTGCCCCGGGGGGCTCCA

GCCTACAACCCAACAGGTCCACAAGTGACACCTCTTGCCAGGGGCACCTTCCAGAGAGCTGAGCGCTTCCCAGCTAGCAGCCGGACTCCCCTCTGTGGGC

ACTGTAACAATGTCATCAG - UNI35722 - GGGCCCTTTTCTGGTGGCCATGGGCCGCTCTTGGCACCCAGAAGAGTTCAATTGTGCCTACTGCAAG

ACCTCCCTAGCAGATGTGTGCTTTGTGGAGGAGCAGAACAACGTTTACTGCGAGCGGTGTTACGAGCAGTTCTTTGCCCCGATCTGTGCCAAATGTAACA

CCAAAATCATGGGG - UNI31167 - GAAGTGATGCACGCTCTGCGACAGACATGGCACACCACCTGCTTTGTCTGTGCAGCCTGCAAGAAGCCCTTT

GGGAACAGCCTCTTCCACATGGAGGATGGAGAGCCATACTGTGAGAAAG - UNI31167 - ACTACATCAACCTGTTCAGCACCAAGTGCCATGGATG

CGATTTCCCTGTGGAAGCTGGTGACAAGTTTATCGAGGCCCTGGGGCACACCTGGCATGACACCTGCTTCATTTGTGCG - UNI19103 - - UNI31

167 - GTCTGCCACGTGAATCTGGAGGGTCAGCCATTCTACTCTAAGAAAGACAAACCACTGTGCAAGAAGCACGCACATGCCATCAACGTGTAGGAGC

CCAGAGTGGCTGGTGTGCCAAGCCCAGGCTGCTCCTGCTACTGATGACGAAGGAGTCAAAGAAGCTGATGTTGTTTCTTCTGGGAGGGAAGGGGAACGAG

AGAAAATGGTTGAGCCCTTTTGAAGTCTAACTTTAGTCTTTTCTTGTATACACAGATTGTGTATTATTGTAGTTCAGACTAGAAGCCAAAAGAAGATTCT

AAACCCAGCTAGTAATTAATCCACGGCTGGAATTGGACTTCAGGTTTTGGGGAAATGACTCCAAGAAATCAACAGTGAAAAACAAACAAAAAAACAATGT

TAAAAAATCAAAGACTCCCTAGCCATGTCTGTTGCCAGTGTGGGGACAGAGCCCTGGGCAGTTATGGAGGATCTAAAGTGTGCAGCGGAGCTCTGGAGCG

ATCCTTGGCAAGCACAACGATGTGCCAAGCAGTGTTTGCTGTGCGGATATTTTTAGAGCCGGCACTGAGAGCTCCTTAGCTAAGACCCATTGGGCTTTCC

TCACCAAAAAAGGAAGAGTTGTTCCATTAGCATCACAGAGTTACCTCTGCACATCAGACTTCAGATGTTGAACAAACTTGAAACATATAAGGGGAGCCCA

GGCGTCTGAGGCAATGGCGGGCCACCACTGGGCAAGTGAAAAGGCTCCGGGGAGGTCTTTCGCTCACGCCACGGACAGGGGAGAAAAGATGAGCTTTCTC

TGCATCTCCCCCTCTTTCCCTCTGAAATATCTAAAGTCCCTGGAAGGCTTTGCTCCTTTATGAATTGTTAAGGGAAAGTGAAATTGGGTTTCTCCAGTTT

TGCTTTACAATGTATGAGAAGAGGTTTGAAAAGGACTCTGGGTGGGGTTTTAGCCTTTGTTTTGCTTTAAGAGGGTTCTGAGAGGGAGTGTTCTGTGCAC

GTATTTCACCCCCTACCCGCAACAGCTCACGAACATCTTCCTCAGCCCCACCCTCAAATAGGCTCAGTGGGAAAAAGAGAGACAGCATCAAACAGGATGC

TAGAACGGGCTCCCGGGAGCACCTGCGCACATGCTCATGGAGAGAGGATGCTCTGCTAACCTCAGGAAGAATGCATGGGCTGCAGGACCTCCCATCTCCA

GAGCTGCACCATCCCCTTAACCTGTTCCTTTAAGTGCAGCACAGGAAGTATATACTCATGCTGACTGCTGCAAGGAGGAAAAGCTGCATTTGCCATTTGG

GCCAATATTTGAAAATAGTTGACTGGCTTTAGAATATTTATTGAAATAGACCTGGCCTTCAGACTCTATAACAATACAGGTGACTCTTTTACATATACAT

GGAATTAGGTGAGCTTGGTAAAGCTATTTAGAAGTAAAGAAAGTGGCTTCCCTTTTGGGTTTCGAGATGGTGCAATCACCTTCCTTTCTAGGAAGTGCTG

TTAGGAAGGATGTTCATTGAAAATGGTATTGAAGCAGGTTGTGTGTATGTGTGTGTGTGTATGTGTGTGTTTCTCACTGGAGCACAGTATGTAGGCACTG

TACCAACCACTGCCCTTCTCTCCTCCAACCTGTTTTGGATTTTCCACTTTGCACGGTTGAAATGTTTTATAGGTATGCATTCACACTTTTCTTCTTTTGA

GAACTAAGACTTCCAAGAGAGCATCCTCCTACTTACCGGTCTCTCCTCCCTGGAAGACTCTGAATTAGTTAGACATTGTGTAGTAGGAAGTCCATAGTTA

GTTTGGAATCACCAATTCCGCCCAGGCAGCACCAGGGAAGGTCAGAACTATGCTCCTCCAAACAGCTCTTCTTTACTTTTTATGCAAAGCTCCTGGCTGA

GTGCATTCTGCTGGGACAGCTCAGAGGTTTGTCCAGACATGCAGAACAGTACCTTGTGTAGTCTGTTATTTTTGGAAATTTCAGATATTCAGGGACAAGG

AGCTTGCTGACTAAACAGAAGGCTTCTAAGCAGTTGATTTTTTTTTTAATCTATTAAATGATTGGGAACTGATCTTGAGGAAGGGAAATAAAAACCCCTG

CCATTACATTTCCAAAATGTCTTTTTAAAGGTTTTATACATGATCCCAGACACTGCTCCTGTGTAATCATTATCCTTTGTTGTAGGATCCTTAAGAAGAT

AATCAAAATATCCTAAAGGAAAGCATCACCATTCTCCTATGTTAAGTAATTTAAAACAAATATTTAATAGCTTACATGTATTTTTAAGTGACTCTTATTT

TTTAAATACAAAACAACATTTAGAGGCTGGGTGTAATTCAGTGGTACAGAATTGTCCTAGAATTTAGGATTCTCTAGCTTTGGTCCCCAGCACTGCCAAA

AACCAATATAAAGGTAGCAGAGAAGAAGCCAGTTTCAAGAATGGTCCACAGGGTGAGCATGCATAGTGTTAAGATTAAGGCTGAATGTCGATAGGTTACC

ATCACATCTTTACTAGTGCATAGGAGGAATACAGTGTGTCTTGTTTTCTTATTCTTGGCATTAATCTAATATACTGATAAACACTCACCTTCTGAGTAGA

ATGGCTTGTATTGGCAGTGTTTGTGTTAGCAATCTAGCCTTTGTAATGTGAACTTTCAACCCTAGCATTCTTGCTTTGGGGTCTTCTTCCTTTCTTTTTG

GTAAGTTTTCTGAAGTTGGAATATAGTGTGTTAGAGGTGTGTGTAAAACTATTTTGCATGGTTTTCTTTTCCTTTATTTTCCTTTTCTTTCTTTTTGGTC

CGTGTGGATTCTTTTTAGCAAAATAAAATTCAGAAAAAAAAAAGATATACAAATGGC
Translation
 MSYSVTLTGPGPWGFRLQGGKDFNMPLTISR ITPGSKAAQSQLSQGDLVVAIDGVNTDTMTHLEAQNKIKSASYNLSLTLQK KSKRPIPISTTAPPI

QSPLPVIPHQK DPALDTNGSLATPSPSPEARASPGALEFGDTFSSSFSQTSVCSPLMEASGPVLPLGSPVAKASSEGAQGSVSPKVLPGPSQPRQYNNP

IGLYSAETLREMAQMYQMSLRGKASGAGLLGG GSLPVKDLAVDSASPVYQAVIKTQSKPEDEADEWARRSSNLQSRSFRILAQMTGTEYM MQDPDEEA

LRRSR - UNI35722 - RPQASAYSPAAAASPAPSAHTSYSEGPAAPAPKPRVVTTASIRPSVYQPV - UNI35722 - VPASSYSPSPGANYSPT

PYTPSPAPAYTPSPAPTYTPSPAPTYSPSPAPAYTPSPAPNYTPTPSAAYSGGPSESASRPPWVTDDSFSQKFAPGKSTTTVSKQTLPRGAPAYNPTGPQ

VTPLARGTFQRAERFPASSRTPLCGHCNNVIR - UNI35722 - RGPFLVAMGRSWHPEEFNCAYCKTSLADVCFVEEQNNVYCERCYEQFFAPICAK

CNTKIMG - UNI31167 - EVMHALRQTWHTTCFVCAACKKPFGNSLFHMEDGEPYCEKD - UNI31167 - DYINLFSTKCHGCDFPVEAGDKFI

EALGHTWHDTCFICA - UNI19103 - - UNI31167 - VCHVNLEGQPFYSKKDKPLCKKHAHAINV
Transcript ENSMUST00000064098
Sequence
CGATGGCATTCACTCCCAGCTATTCTTAGGAGCCTCCCAGGAGCTCTGCACAGCCTGGCCAGGCAGCAAGGAACGCAGCAG AGGAAGCCACCGCTGTCA

GCACCAGTATGTCTTACAGTGTGACTCTGACTGGGCCTGGGCCCTGGGGCTTCCGTCTGCAGGGAGGCAAGGACTTCAACATGCCCCTCACTATCTCCCG

G ATCACTCCAGGCAGCAAGGCAGCCCAGTCCCAGCTCAGCCAAGGAGACCTGGTGGTGGCCATTGATGGCGTCAACACAGACACCATGACCCACCTGGA

GGCCCAGAACAAGATCAAGTCGGCCAGCTACAACCTGAGCCTCACTCTACAGAA GTCCAAGCGGCCTATTCCCATCTCCACGACAGCGCCTCCCATCCA

GTCCCCGCTGCCAGTGATCCCCCACCAGAAG GTGGTAGCCAATTCTCCAGCCAA TGCTGACTACCAGGAACGCTTCAACCCCAGCGTCCTGAAGGACT

CAGCCCTGTCCACCCACAAGCCCATTGAAGTGAAGGGCTTGGGAGGCAAGGCCACTATCATCCACGCTCAGTACAACACCCCGATCAGCATGTACTCACA

GGATGCTATCATGGACGCCATCGCGGGGCAGGCCCAGGCCCAGGGCAGTGACTTCAGTGG GAGCCTCCCTGTGAAAGACTTGGCGGTGGACAGCGCCTC

TCCTGTGTACCAGGCTGTGATCAAAACCCAAAGCAAGCCGGAAGATGAGGCTGATGAGTGGGCCCGCCGGTCCTCCAACCTGCAGTCTCGCTCCTTCCGC

ATCCTGGCCCAGATGACCGGGACAGAATACA TGCAAGACCCTGATGAAGAGGCTCTGCGAAGGTCAAG CACCCCTATTGAGCATGCTCCAGTGTGCAC

CAGCCAGGCCACTTCCCCGCTGCTGCCTGCTTCTGCCCAGTCGCCCGCTGCTGCCTCTCCCATTGCGGCCTCGCCAACCCTGGCCACAGCTGCTGCCACC

CATGCTGCTGCCGCCTCTGCTGCAGGCCCTGCCGCAAGTCCCGTGGAGAATCCGAG - UNI35722 - GCCACAGGCCTCTGCTTACAGTCCTGCAGC

CGCCGCTTCTCCAGCACCCTCTGCCCATACCAGCTACAGCGAGGGTCCAGCTGCCCCTGCACCCAAGCCTCGGGTCGTAACCACTGCCAGCATCCGGCCT

TCTGTCTACCAGCCAG - UNI35722 - TGCCTGCATCTTCCTACAGCCCATCTCCAGGAGCCAATTACAGTCCAACTCCCTATACCCCTTCGCCAGC

TCCTGCTTATACCCCCTCTCCTGCTCCCACCTATACCCCCTCACCTGCACCTACATACTCCCCTTCCCCTGCACCAGCTTATACCCCCTCACCTGCCCCA

AACTATACCCCTACACCATCAGCTGCCTACAGTGGGGGCCCTTCAGAATCTGCCAGCCGTCCACCCTGGGTGACCGATGACAGCTTCTCTCAGAAGTTTG

CTCCTGGAAAGAGCACTACCACTGTCAGCAAGCAGACCCTGCCCCGGGGGGCTCCAGCCTACAACCCAACAGGTCCACAAGTGACACCTCTTGCCAGGGG

CACCTTCCAGAGAGCTGAGCGCTTCCCAGCTAGCAGCCGGACTCCCCTCTGTGGGCACTGTAACAATGTCATCAG - UNI35722 - GGGCCCTTTTC

TGGTGGCCATGGGCCGCTCTTGGCACCCAGAAGAGTTCAATTGTGCCTACTGCAAGACCTCCCTAGCAGATGTGTGCTTTGTGGAGGAGCAGAACAACGT

TTACTGCGAGCGGTGTTACGAGCAGTTCTTTGCCCCGATCTGTGCCAAATGTAACACCAAAATCATGGGG - UNI31167 - GAAGTGATGCACGCTC

TGCGACAGACATGGCACACCACCTGCTTTGTCTGTGCAGCCTGCAAGAAGCCCTTTGGGAACAGCCTCTTCCACATGGAGGATGGAGAGCCATACTGTGA

GAAAG - UNI31167 - ACTACATCAACCTGTTCAGCACCAAGTGCCATGGATGCGATTTCCCTGTGGAAGCTGGTGACAAGTTTATCGAGGCCCTGG

GGCACACCTGGCATGACACCTGCTTCATTTGTGCG - UNI19103 - - UNI31167 - GTCTGCCACGTGAATCTGGAGGGTCAGCCATTCTACTC

TAAGAAAGACAAACCACTGTGCAAGAAGCACGCACATGCCATCAACGTGTAGGAGCCCAGAGTGGCTGGTGTGCCAAGCCCAGGCTGCTCCTGCTACTGA

TGACGAAGGAGTCAAAGAAGCTGATGTTGTTTCTTCTGGGAGGGAAGGGGAACGAGAGAAAATGGTTGAGCCCTTTTGAAGTCTAACTTTAGTCTTTTCT

TGTATACACAGATTGTGTATTATTGTAGTTCAGACTAGAAGCCAAAAGAAGATTCTAAACCCAGCTAGTAATTAATCCACGGCTGGAATTGGACTTCAGG

TTTTGGGGAAATGACTCCAAGAAATCAACAGTGAAAAACAAACAAAAAAACAATGTTAAAAAATCAAAGACTCCCTAGCCATGTCTGTTGCCAGTGTGGG

GACAGAGCCCTGGGCAGTTATGGAGGATCTAAAGTGTGCAGCGGAGCTCTGGAGCGATCCTTGGCAAGCACAACGATGTGCCAAGCAGTGTTTGCTGTGC

GGATATTTTTAGAGCCGGCACTGAGAGCTCCTTAGCTAAGACCCATTGGGCTTTCCTCACCAAAAAAGGAAGAGTTGTTCCATTAGCATCACAGAGTTAC

CTCTGCACATCAGACTTCAGATGTTGAACAAACTTGAAACATATAAGGGGAGCCCAGGCGTCTGAGGCAATGGCGGGCCACCACTGGGCAAGTGAAAAGG

CTCCGGGGAGGTCTTTCGCTCACGCCACGGACAGGGGAGAAAAGATGAGCTTTCTCTGCATCTCCCCCTCTTTCCCTCTGAAATATCTAAAGTCCCTGGA

AGGCTTTGCTCCTTTATGAATTGTTAAGGGAAAGTGAAATTGGGTTTCTCCAGTTTTGCTTTACAATGTATGAGAAGAGGTTTGAAAAGGACTCTGGGTG

GGGTTTTAGCCTTTGTTTTGCTTTAAGAGGGTTCTGAGAGGGAGTGTTCTGTGCACGTATTTCACCCCCTACCCGCAACAGCTCACGAACATCTTCCTCA

GCCCCACCCTCAAATAGGCTCAGTGGGAAAAAGAGAGACAGCATCAAACAGGATGCTAGAACGGGCTCCCGGGAGCACCTGCGCACATGCTCATGGAGAG

AGGATGCTCTGCTAACCTCAGGAAGAATGCATGGGCTGCAGGACCTCCCATCTCCAGAGCTGCACCATCCCCTTAACCTGTTCCTTTAAGTGCAGCACAG

GAAGTATATACTCATGCTGACTGCTGCAAGGAGGAAAAGCTGCATTTGCCATTTGGGCCAATATTTGAAAATAGTTGACTGGCTTTAGAATATTTATTGA

AATAGACCTGGCCTTCAGACTCTATAACAATACAGGTGACTCTTTTACATATACATGGAATTAGGTGAGCTTGGTAAAGCTATTTAGAAGTAAAGAAAGT

GGCTTCCCTTTTGGGTTTCGAGATGGTGCAATCACCTTCCTTTCTAGGAAGTGCTGTTAGGAAGGATGTTCATTGAAAATGGTATTGAAGCAGGTTGTGT

GTATGTGTGTGTGTGTATGTGTGTGTTTCTCACTGGAGCACAGTATGTAGGCACTGTACCAACCACTGCCCTTCTCTCCTCCAACCTGTTTTGGATTTTC

CACTTTGCACGGTTGAAATGTTTTATAGGTATGCATTCACACTTTTCTTCTTTTGAGAACTAAGACTTCCAAGAGAGCATCCTCCTACTTACCGGTCTCT

CCTCCCTGGAAGACTCTGAATTAGTTAGACATTGTGTAGTAGGAAGTCCATAGTTAGTTTGGAATCACCAATTCCGCCCAGGCAGCACCAGGGAAGGTCA

GAACTATGCTCCTCCAAACAGCTCTTCTTTACTTTTTATGCAAAGCTCCTGGCTGAGTGCATTCTGCTGGGACAGCTCAGAGGTTTGTCCAGACATGCAG

AACAGTACCTTGTGTAGTCTGTTATTTTTGGAAATTTCAGATATTCAGGGACAAGGAGCTTGCTGACTAAACAGAAGGCTTCTAAGCAGTTGATTTTTTT

TTTAATCTATTAAATGATTGGGAACTGATCTTGAGGAAGGGAAATAAAAACCCCTGCCATTACATTTCCAAAATGTCTTTTTAAAGGTTTTATACATGAT

CCCAGACACTGCTCCTGTGTAATCATTATCCTTTGTTGTAGGATCCTTAAGAAGATAATCAAAATATCCTAAAGGAAAGCATCACCATTCTCCTATGTTA

AGTAATTTAAAACAAATATTTAATAGCTTACATGTATTTTTAAGTGACTCTTATTTTTTAAATACAAAACAACATTTAGAGGCTGGGTGTAATTCAGTGG

TACAGAATTGTCCTAGAATTTAGGATTCTCTAGCTTTGGTCCCCAGCACTGCCAAAAACCAATATAAAGGTAGCAGAGAAGAAGCCAGTTTCAAGAATGG

TCCACAGGGTGAGCATGCATAGTGTTAAGATTAAGGCTGAATGTCGATAGGTTACCATCACATCTTTACTAGTGCATAGGAGGAATACAGTGTGTCTTGT

TTTCTTATTCTTGGCATTAATCTAATATACTGATAAACACTCACCTTCTGAGTAGAATGGCTTGTATTGGCAGTGTTTGTGTTAGCAATCTAGCCTTTGT

AATGTGAACTTTCAACCCTAGCATTCTTGCTTTGGGGTCTTCTTCCTTTCTTTTTGGTAAGTTTTCTGAAGTTGGAATATAGTGTGTTAGAGGTGTGTGT

AAAACTATTTTGCATGGTTTTCTTTTCCTTTATTTTCCTTTTCTTTCTTTTTGGTCCGTGTGGATTCTTTTTAGCAAAATAAAATTCAGAAAAAAAAAAG

ATATACAAATGGC
Translation
 MSYSVTLTGPGPWGFRLQGGKDFNMPLTISR ITPGSKAAQSQLSQGDLVVAIDGVNTDTMTHLEAQNKIKSASYNLSLTLQK KSKRPIPISTTAPPI

QSPLPVIPHQK VVANSPAN NADYQERFNPSVLKDSALSTHKPIEVKGLGGKATIIHAQYNTPISMYSQDAIMDAIAGQAQAQGSDFSG GSLPVKDLA

VDSASPVYQAVIKTQSKPEDEADEWARRSSNLQSRSFRILAQMTGTEYM MQDPDEEALRRSS STPIEHAPVCTSQATSPLLPASAQSPAAASPIAASP

TLATAAATHAAAASAAGPAASPVENPR - UNI35722 - RPQASAYSPAAAASPAPSAHTSYSEGPAAPAPKPRVVTTASIRPSVYQPV - UNI357

22 - VPASSYSPSPGANYSPTPYTPSPAPAYTPSPAPTYTPSPAPTYSPSPAPAYTPSPAPNYTPTPSAAYSGGPSESASRPPWVTDDSFSQKFAPGKS

TTTVSKQTLPRGAPAYNPTGPQVTPLARGTFQRAERFPASSRTPLCGHCNNVIR - UNI35722 - RGPFLVAMGRSWHPEEFNCAYCKTSLADVCFV

EEQNNVYCERCYEQFFAPICAKCNTKIMG - UNI31167 - EVMHALRQTWHTTCFVCAACKKPFGNSLFHMEDGEPYCEKD - UNI31167 - DY

INLFSTKCHGCDFPVEAGDKFIEALGHTWHDTCFICA - UNI19103 - - UNI31167 - VCHVNLEGQPFYSKKDKPLCKKHAHAINV
Transcript ENSMUST00000022327
Sequence
CGATGGCATTCACTCCCAGCTATTCTTAGGAGCCTCCCAGGAGCTCTGCACAGCCTGGCCAGGCAGCAAGGAACGCAGCAG AGGAAGCCACCGCTGTCA

GCACCAGTATGTCTTACAGTGTGACTCTGACTGGGCCTGGGCCCTGGGGCTTCCGTCTGCAGGGAGGCAAGGACTTCAACATGCCCCTCACTATCTCCCG

G ATCACTCCAGGCAGCAAGGCAGCCCAGTCCCAGCTCAGCCAAGGAGACCTGGTGGTGGCCATTGATGGCGTCAACACAGACACCATGACCCACCTGGA

GGCCCAGAACAAGATCAAGTCGGCCAGCTACAACCTGAGCCTCACTCTACAGAA GTCCAAGCGGCCTATTCCCATCTCCACGACAGCGCCTCCCATCCA

GTCCCCGCTGCCAGTGATCCCCCACCAGAAG GACCCTGCTCTGGACACGAACGGCAGCCTGGCGACTCCCAGCCCCAGCCCTGAGGCAAGGGCCAGCCC

AGGCGCCCTGGAGTTCGGGGACACCTTTAGCTCCTCCTTCTCCCAGACCTCTGTCTGCAGCCCACTCATGGAGGCCTCGGGGCCTGTCCTTCCTCTGGGT

AGCCCAGTGGCCAAGGCCAGCTCAGAGGGTGCACAGGGCTCAGTCAGCCCCAAAGTTCTGCCAGGCCCCAGCCAACCGAGGCAATATAACAACCCCATTG

GCCTGTACTCAGCAGAGACCCTGAGGGAGATGGCTCAGATGTATCAGATGAGCCTCCGAGGGAAGGCCTCAGGTGCTGGACTCCTAGGAGG GAGCCTCC

CTGTGAAAGACTTGGCGGTGGACAGCGCCTCTCCTGTGTACCAGGCTGTGATCAAAACCCAAAGCAAGCCGGAAGATGAGGCTGATGAGTGGGCCCGCCG

GTCCTCCAACCTGCAGTCTCGCTCCTTCCGCATCCTGGCCCAGATGACCGGGACAGAATACA TGCAAGACCCTGATGAAGAGGCTCTGCGAAGGTCAAG

 CACCCCTATTGAGCATGCTCCAGTGTGCACCAGCCAGGCCACTTCCCCGCTGCTGCCTGCTTCTGCCCAGTCGCCCGCTGCTGCCTCTCCCATTGCGGC

CTCGCCAACCCTGGCCACAGCTGCTGCCACCCATGCTGCTGCCGCCTCTGCTGCAGGCCCTGCCGCAAGTCCCGTGGAGAATCCGAG - UNI35722 -

 GCCACAGGCCTCTGCTTACAGTCCTGCAGCCGCCGCTTCTCCAGCACCCTCTGCCCATACCAGCTACAGCGAGGGTCCAGCTGCCCCTGCACCCAAGCC

TCGGGTCGTAACCACTGCCAGCATCCGGCCTTCTGTCTACCAGCCAG - UNI35722 - TGCCTGCATCTTCCTACAGCCCATCTCCAGGAGCCAATT

ACAGTCCAACTCCCTATACCCCTTCGCCAGCTCCTGCTTATACCCCCTCTCCTGCTCCCACCTATACCCCCTCACCTGCACCTACATACTCCCCTTCCCC

TGCACCAGCTTATACCCCCTCACCTGCCCCAAACTATACCCCTACACCATCAGCTGCCTACAGTGGGGGCCCTTCAGAATCTGCCAGCCGTCCACCCTGG

GTGACCGATGACAGCTTCTCTCAGAAGTTTGCTCCTGGAAAGAGCACTACCACTGTCAGCAAGCAGACCCTGCCCCGGGGGGCTCCAGCCTACAACCCAA

CAGGTCCACAAGTGACACCTCTTGCCAGGGGCACCTTCCAGAGAGCTGAGCGCTTCCCAGCTAGCAGCCGGACTCCCCTCTGTGGGCACTGTAACAATGT

CATCAG - UNI35722 - GGGCCCTTTTCTGGTGGCCATGGGCCGCTCTTGGCACCCAGAAGAGTTCAATTGTGCCTACTGCAAGACCTCCCTAGCAG

ATGTGTGCTTTGTGGAGGAGCAGAACAACGTTTACTGCGAGCGGTGTTACGAGCAGTTCTTTGCCCCGATCTGTGCCAAATGTAACACCAAAATCATGGG

G - UNI31167 - GAAGTGATGCACGCTCTGCGACAGACATGGCACACCACCTGCTTTGTCTGTGCAGCCTGCAAGAAGCCCTTTGGGAACAGCCTCT

TCCACATGGAGGATGGAGAGCCATACTGTGAGAAAG - UNI31167 - ACTACATCAACCTGTTCAGCACCAAGTGCCATGGATGCGATTTCCCTGTG

GAAGCTGGTGACAAGTTTATCGAGGCCCTGGGGCACACCTGGCATGACACCTGCTTCATTTGTGCG - UNI19103 - - UNI31167 - GTCTGCC

ACGTGAATCTGGAGGGTCAGCCATTCTACTCTAAGAAAGACAAACCACTGTGCAAGAAGCACGCACATGCCATCAACGTGTAGGAGCCCAGAGTGGCTGG

TGTGCCAAGCCCAGGCTGCTCCTGCTACTGATGACGAAGGAGTCAAAGAAGCTGATGTTGTTTCTTCTGGGAGGGAAGGGGAACGAGAGAAAATGGTTGA

GCCCTTTTGAAGTCTAACTTTAGTCTTTTCTTGTATACACAGATTGTGTATTATTGTAGTTCAGACTAGAAGCCAAAAGAAGATTCTAAACCCAGCTAGT

AATTAATCCACGGCTGGAATTGGACTTCAGGTTTTGGGGAAATGACTCCAAGAAATCAACAGTGAAAAACAAACAAAAAAACAATGTTAAAAAATCAAAG

ACTCCCTAGCCATGTCTGTTGCCAGTGTGGGGACAGAGCCCTGGGCAGTTATGGAGGATCTAAAGTGTGCAGCGGAGCTCTGGAGCGATCCTTGGCAAGC

ACAACGATGTGCCAAGCAGTGTTTGCTGTGCGGATATTTTTAGAGCCGGCACTGAGAGCTCCTTAGCTAAGACCCATTGGGCTTTCCTCACCAAAAAAGG

AAGAGTTGTTCCATTAGCATCACAGAGTTACCTCTGCACATCAGACTTCAGATGTTGAACAAACTTGAAACATATAAGGGGAGCCCAGGCGTCTGAGGCA

ATGGCGGGCCACCACTGGGCAAGTGAAAAGGCTCCGGGGAGGTCTTTCGCTCACGCCACGGACAGGGGAGAAAAGATGAGCTTTCTCTGCATCTCCCCCT

CTTTCCCTCTGAAATATCTAAAGTCCCTGGAAGGCTTTGCTCCTTTATGAATTGTTAAGGGAAAGTGAAATTGGGTTTCTCCAGTTTTGCTTTACAATGT

ATGAGAAGAGGTTTGAAAAGGACTCTGGGTGGGGTTTTAGCCTTTGTTTTGCTTTAAGAGGGTTCTGAGAGGGAGTGTTCTGTGCACGTATTTCACCCCC

TACCCGCAACAGCTCACGAACATCTTCCTCAGCCCCACCCTCAAATAGGCTCAGTGGGAAAAAGAGAGACAGCATCAAACAGGATGCTAGAACGGGCTCC

CGGGAGCACCTGCGCACATGCTCATGGAGAGAGGATGCTCTGCTAACCTCAGGAAGAATGCATGGGCTGCAGGACCTCCCATCTCCAGAGCTGCACCATC

CCCTTAACCTGTTCCTTTAAGTGCAGCACAGGAAGTATATACTCATGCTGACTGCTGCAAGGAGGAAAAGCTGCATTTGCCATTTGGGCCAATATTTGAA

AATAGTTGACTGGCTTTAGAATATTTATTGAAATAGACCTGGCCTTCAGACTCTATAACAATACAGGTGACTCTTTTACATATACATGGAATTAGGTGAG

CTTGGTAAAGCTATTTAGAAGTAAAGAAAGTGGCTTCCCTTTTGGGTTTCGAGATGGTGCAATCACCTTCCTTTCTAGGAAGTGCTGTTAGGAAGGATGT

TCATTGAAAATGGTATTGAAGCAGGTTGTGTGTATGTGTGTGTGTGTATGTGTGTGTTTCTCACTGGAGCACAGTATGTAGGCACTGTACCAACCACTGC

CCTTCTCTCCTCCAACCTGTTTTGGATTTTCCACTTTGCACGGTTGAAATGTTTTATAGGTATGCATTCACACTTTTCTTCTTTTGAGAACTAAGACTTC

CAAGAGAGCATCCTCCTACTTACCGGTCTCTCCTCCCTGGAAGACTCTGAATTAGTTAGACATTGTGTAGTAGGAAGTCCATAGTTAGTTTGGAATCACC

AATTCCGCCCAGGCAGCACCAGGGAAGGTCAGAACTATGCTCCTCCAAACAGCTCTTCTTTACTTTTTATGCAAAGCTCCTGGCTGAGTGCATTCTGCTG

GGACAGCTCAGAGGTTTGTCCAGACATGCAGAACAGTACCTTGTGTAGTCTGTTATTTTTGGAAATTTCAGATATTCAGGGACAAGGAGCTTGCTGACTA

AACAGAAGGCTTCTAAGCAGTTGATTTTTTTTTTAATCTATTAAATGATTGGGAACTGATCTTGAGGAAGGGAAATAAAAACCCCTGCCATTACATTTCC

AAAATGTCTTTTTAAAGGTTTTATACATGATCCCAGACACTGCTCCTGTGTAATCATTATCCTTTGTTGTAGGATCCTTAAGAAGATAATCAAAATATCC

TAAAGGAAAGCATCACCATTCTCCTATGTTAAGTAATTTAAAACAAATATTTAATAGCTTACATGTATTTTTAAGTGACTCTTATTTTTTAAATACAAAA

CAACATTTAGAGGCTGGGTGTAATTCAGTGGTACAGAATTGTCCTAGAATTTAGGATTCTCTAGCTTTGGTCCCCAGCACTGCCAAAAACCAATATAAAG

GTAGCAGAGAAGAAGCCAGTTTCAAGAATGGTCCACAGGGTGAGCATGCATAGTGTTAAGATTAAGGCTGAATGTCGATAGGTTACCATCACATCTTTAC

TAGTGCATAGGAGGAATACAGTGTGTCTTGTTTTCTTATTCTTGGCATTAATCTAATATACTGATAAACACTCACCTTCTGAGTAGAATGGCTTGTATTG

GCAGTGTTTGTGTTAGCAATCTAGCCTTTGTAATGTGAACTTTCAACCCTAGCATTCTTGCTTTGGGGTCTTCTTCCTTTCTTTTTGGTAAGTTTTCTGA

AGTTGGAATATAGTGTGTTAGAGGTGTGTGTAAAACTATTTTGCATGGTTTTCTTTTCCTTTATTTTCCTTTTCTTTCTTTTTGGTCCGTGTGGATTCTT

TTTAGCAAAATAAAATTCAGAAAAAAAAAAGATATACAAATGGC
Translation
 MSYSVTLTGPGPWGFRLQGGKDFNMPLTISR ITPGSKAAQSQLSQGDLVVAIDGVNTDTMTHLEAQNKIKSASYNLSLTLQK KSKRPIPISTTAPPI

QSPLPVIPHQK DPALDTNGSLATPSPSPEARASPGALEFGDTFSSSFSQTSVCSPLMEASGPVLPLGSPVAKASSEGAQGSVSPKVLPGPSQPRQYNNP

IGLYSAETLREMAQMYQMSLRGKASGAGLLGG GSLPVKDLAVDSASPVYQAVIKTQSKPEDEADEWARRSSNLQSRSFRILAQMTGTEYM MQDPDEEA

LRRSS STPIEHAPVCTSQATSPLLPASAQSPAAASPIAASPTLATAAATHAAAASAAGPAASPVENPR - UNI35722 - RPQASAYSPAAAASPAP

SAHTSYSEGPAAPAPKPRVVTTASIRPSVYQPV - UNI35722 - VPASSYSPSPGANYSPTPYTPSPAPAYTPSPAPTYTPSPAPTYSPSPAPAYTP

SPAPNYTPTPSAAYSGGPSESASRPPWVTDDSFSQKFAPGKSTTTVSKQTLPRGAPAYNPTGPQVTPLARGTFQRAERFPASSRTPLCGHCNNVIR - U

NI35722 - RGPFLVAMGRSWHPEEFNCAYCKTSLADVCFVEEQNNVYCERCYEQFFAPICAKCNTKIMG - UNI31167 - EVMHALRQTWHTTCF

VCAACKKPFGNSLFHMEDGEPYCEKD - UNI31167 - DYINLFSTKCHGCDFPVEAGDKFIEALGHTWHDTCFICA - UNI19103 - - UNI31

167 - VCHVNLEGQPFYSKKDKPLCKKHAHAINV

For any suggestions or comments, please send an email to unitrap@crg.es