Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000021879 (Dnahc7l)
Chromosomal location
Chr 14: 27512898 - 27543988 (+)
Description
dynein, axonemal, heavy chain 7-like Gene [Source:MGI Symbol;Acc:MGI:2685130]
UniGene
Mm.271304 
MGI
MGI:2685130 
Uniprot/SWISSPROT
Q8BVT4 
Human Ortholog
ENSG00000174844 (DNAH12L)
Omim not available
UniTrap UNI31344
Vector Insertion
Chr 14: 27516914 - 27525507
Public Clones (sanger) IST14025A12 (tigm) IST11838C9 (tigm) IST13898A6 (tigm) IST14563B3 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 21% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000022433
Sequence
GAGTATAGTGTGTTTTAATACTCAGGAGACCAAGATGTCAGATCCTAACAAAACTGCCATTGCAGCAGAAAAGGAAGCTTTGAACTTGAAGTTGCCCCCC

ATTGTTCAACCCCCCAAAAACATAGGGGTCGACACACCAAAACAGAGTGAGCTGCTAAAGTACAGACGGTCTAAGGAGCAGCAGAAGAAGATCAATCAGT

TAGT AATTTCTGGAGCTAAAAAAAGTCTGGACAAAACCCTGGATAAAAGAATACCTCCATTACCAGAGCCAGACTTCCCTCCGACT ATGACCAGTGAA

ATAAAGAAAAGAGGA TTAAACTACATTTTCATGAAGCAGTGTGTAGAGAATAGTCCTATAGTACCCATCCAGTCACAATGGCTGGACAACATGTTAATG

CTGGTACCCGAGCACCTAAAGGAAGGGGAAAAAAGTGAAGAACTGCTTGGAAGTCTCATAGACGAGGTGTCAATGGACTATGAGAAAAGCATGAAGAGAT

ATTTGG - UNI31344 - TACAGAGTGTTCTTGTGAAGCCTCCAGTTAAATGGCTTGAAGATGAAGGGGGCCCTTTGCCTGAATCTCCTGA AGGTCT

AGATTATTCCAATCCTTGGCATTCTAACTTTGTGCAAGCAAGAAGTCAAATATTAGCTAATTTGCACATTGTTCATCCAACTATGAAAATGTTACTGGAG

CTTGGTTATACAGCATTTGCTAAAATAATTCTGCTGGACTTAACAGGAATTAG AGCTAGAGGCCCAATTGATTGTGAAGCGCTGAGAAATGATCTATCA

ATTCAAGCTAGAAAATCAGAAGAGAAGATAATGAACACATGGTATCCAAAGGTTATAAATCTCTTTACTAAGAAGGAGGCACTAGAAGGCATCAAGACTG

AAAAATTGGATTCCTTTTATAACTGTGTTTCCATACTTATGTCAAATCAG CTAAAGGATCTCTTATGGAGAACTGTAGAAGAATTCATAAAACTCTTTG

ATCCAAGATATCTAAATAGGCTTCCAATATTTAAGATGGAGTTGACATTTGATGATGATAAAATGGAATTTTATCCCACCTTTCAAGATTTGGAAGATGT

TGTCTTGGGTTTGATAGAACGGATATCTGAAACTCTGCAG ACTGTCCAAACAGTACCTTCTTGGCTGTCAGGAACGTCATCGCCTGTTAATCTTGATAC

AGAAATTCCAGAACATGTGCTACAGTGGGCTCTCTGTACACTAAGGACAGCCATACAGCATAACTTAGAAGGTGCAAAAGCACATCACAAAACATATG T

TACAAAATACAACTGGCTCCTTGACGGGACTGCAACAAAGATGATACAGAGGTTCCAGGCAGAAAACCACACTTTTGATGAGTACACAGAG TTTATAGA

AAAATTTTTCAATCTTGCTTCAGAAATAATGCTTTTGCCCCAGTGGGCTCATTATCCTATGGTTCGTTTGGACTGTGAAGACTTGAAGATAGGCTTGACA

AATAAAGCAAGAGCCTTTGCAAACATTTTATTAAATGACATAGCTTCAAAACATAGAAAAGAAAATGAATC TATTTGCAGTGAATTTGAAGCAATTAGA

GACCATGCGCTACGAGTTCCTGAGACCACAGAAGAAATGATGGAGCTAATTGCTTTCGTAGAAAGAGCTCGAACCGTAGGAATTCTTGACTTGGCTCTAA

GGATCCAG GAATCTAAACGCCAAATGAGTTACTTTTTAGATGCTCTTCTAATGTCTCAAGAAGACTTAAATTTAAATGCAACTGTCCTCTTGTGGCCTA

CTAAAATTACCCCTGTCTTTGATGAGAATGATGAA CTCATTGAGAATGCTAAACATGCAAAAGAAAATGAACTAATAGCCAAGAGAGAAAAACTGATTT

TGGAAATAGAAAAAGAATCACGTCGCATGGAGGAGTTCACCGAGTTTGCAGAACTGGACCGCATGCATCAG TATGTGGCAGATGTAAGACAACTGCAGA

AACGGATTCAGGAATCGGAAGAAGCTGTTCAGTTTATTAATAAAGAAGAGGAACTTTTCAAATGGGAATTGACAAAGTATCCTGAGCTGGAAAAATTAAA

AGTCACCATTGAGCCCTACCAGAAGTTTTTTAATTTTGTTCTGAAGTGGCAGCGAACAGAAAAACG GTGGATGGATGGAGGGTTTCTGGACCTTAATGG

AGAAAGTATGGAAGCTGACATAGATGACTTTTCCAGAGAAGTTTTTAGGACACTGAAGTTCTTCCATGCTAAGCAAAAG
Translation
MSDPNKTAIAAEKEALNLKLPPIVQPPKNIGVDTPKQSELLKYRRSKEQQKKINQLV VISGAKKSLDKTLDKRIPPLPEPDFPPT MTSEIKKRG LNY

IFMKQCVENSPIVPIQSQWLDNMLMLVPEHLKEGEKSEELLGSLIDEVSMDYEKSMKRYLV - UNI31344 - VQSVLVKPPVKWLEDEGGPLPESPE

 EGLDYSNPWHSNFVQARSQILANLHIVHPTMKMLLELGYTAFAKIILLDLTGIR RARGPIDCEALRNDLSIQARKSEEKIMNTWYPKVINLFTKKEAL

EGIKTEKLDSFYNCVSILMSNQ LKDLLWRTVEEFIKLFDPRYLNRLPIFKMELTFDDDKMEFYPTFQDLEDVVLGLIERISETLQ TVQTVPSWLSGTS

SPVNLDTEIPEHVLQWALCTLRTAIQHNLEGAKAHHKTYV VTKYNWLLDGTATKMIQRFQAENHTFDEYTE FIEKFFNLASEIMLLPQWAHYPMVRLD

CEDLKIGLTNKARAFANILLNDIASKHRKENES SICSEFEAIRDHALRVPETTEEMMELIAFVERARTVGILDLALRIQ ESKRQMSYFLDALLMSQED

LNLNATVLLWPTKITPVFDENDE LIENAKHAKENELIAKREKLILEIEKESRRMEEFTEFAELDRMHQ YVADVRQLQKRIQESEEAVQFINKEEELFK

WELTKYPELEKLKVTIEPYQKFFNFVLKWQRTEKR RWMDGGFLDLNGESMEADIDDFSREVFRTLKFFHAKQK

For any suggestions or comments, please send an email to unitrap@crg.es