Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000021895 (Arhgef3)
Chromosomal location
Chr 14: 28051225 - 28217090 (+)
Description
Rho guanine nucleotide exchange factor (GEF) 3 Gene [Source:MGI Symbol;Acc:MGI:1918954]
RefSeq_dna
NM_027871 
RefSeq_peptide
NP_082147.1 
MGI
MGI:1918954 
Uniprot/SWISSPROT
Q91X46 
Human Ortholog
ENSG00000163947 (ARHGEF3)
Omim not available
UniTrap UNI35129
Vector Insertion
Chr 14: 28051340 - 28078708
Public Clones (cmhd) IST12355G6 (tigm) IST12098C4 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI8136
Vector Insertion
Chr 14: 28078772 - 28149362
Public Clones RRG363 (baygenomics) IST11836H2 (tigm) IST10118E2 (tigm) IST10836G12 (tigm)
IST12989D9 (tigm) IST10705A5 (tigm) IST14935D12 (tigm) IST14722B3 (tigm)
IST14947D3 (tigm) IST14190A2 (tigm) IST12874G1 (tigm) IST12871H1 (tigm)
IST10925F11 (tigm) IST12081H11HMF1 (tigm) IST10525F5 (tigm) IST10843C2 (tigm)
IST14685A3 (tigm) IST12326C1 (tigm) IST12036C4 (tigm) IST12801A2 (tigm)
IST12009D1 (tigm) IST10087A9 (tigm) IST10333B6 (tigm) IST14305C1 (tigm)
IST11879G9 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI25304
Vector Insertion
Chr 14: 28149456 - 28175975
Public Clones (sanger) E001F11 (ggtc) CMHD-GT_541H8-5S (cmhd) IST10225H2 (tigm)
IST14919E6 (tigm) IST14488G2 (tigm) IST14159F9 (tigm) IST12856H9 (tigm)
IST14849E4 (tigm) IST12132G5 (tigm) IST10212F11 (tigm) IST11829D5 (tigm)
IST11958F11 (tigm) IST10018F6 (tigm) IST14983E1 (tigm) IST12783D10 (tigm)
IST13153H5 (tigm) IST10905G8 (tigm) IST13138H6 (tigm) IST13454F5 (tigm)
IST14516G6 (tigm) IST10242B3 (tigm) IST11696H2 (tigm) IST10332D12 (tigm)
IST12745C8 (tigm) IST12052E4 (tigm) IST10222H10 (tigm) IST14473G2 (tigm)
Private Clones OST188299 (lexicon) OST187435 (lexicon) OST149175 (lexicon)
Severity of mutation (?) Insertion after 6% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI32773
Vector Insertion
Chr 14: 28176084 - 28192776
Public Clones IST14422F10 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 13% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI37137
Vector Insertion
Chr 14: 28192948 - 28197339
Public Clones CMHD-GT_510D10-3 (cmhd)
Private Clones not available
Severity of mutation (?) Insertion after 24% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI33878
Vector Insertion
Chr 14: 28207377 - 28210748
Public Clones IST11605C8 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 55% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI29421
Vector Insertion
Chr 14: 28210920 - 28213450
Public Clones CMHD-GT_426C5-3 (cmhd)
Private Clones not available
Severity of mutation (?) Insertion after 66% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000067296
Sequence
ATGGTGGCCAAGGATTACCCCTTCTACCTCACTGTCAAGAGGGCAAACTGCAGCTTGGAGGCGCCCCTGGGCAGCGGGGTGGCCAAGGACGAG - UNI2

5304 - GAACCTAGTAACAAAAGGGTCAAACCCCTTTCCAGAGTCACATCGCTAGCAAACCTCATTCCACCTGTGAAGACCACACCATTAAAGCGCTTC

AGCCAGACCTTGCAG - UNI32773 - CGGTCCATCAGCTTCCGCAGCGAGAGCCGCCCCGACATCCTTGCCCCCCGAGCTTGGTCCAGAAATGCCAC

CTCCTCAAGCACAAAGCGGAGAGACAGCAAACTGTGGAGTGAGACCTTCGATGTGTGTGTCAATCAGGTGCTCACGGCCAAGGAGATCAAGAGACAGGAG

 GCGATCTTTGAACTTTCTCAAGGTGAAGAAGACTTGATAGAGGACTTGAAATTAGCAAAAAAG GCCTACCACGACCCCATGCTGAAACTCTCCATAAT

GACGGAACAGGAACTGAATCAGATTTTTGGGACCCTGGACTCTCTAATTCCTCTCCATGAAG AGCTCCTCAGTCAGCTTCGAGATGTTCGGAAACCCGA

TGGCTCGACTGAGCACGTTGGTCCCATCCTCGTGGGCTGG CTGCCCTGTCTCAGCTCCTACGACAGCTACTGCAGCAATCAAGTCGCCGCCAAAGCCCT

GCTGGACCACAAAAAGCAGGACCACAGAGTGCAGGACTTCCTCCAGCGCTGTTTAGAATCACCCTTCAGTCGCAAACTCGATCTCTGGAATTTCCTTGAT

ATTCCCCGGAGCCGGCTAGTGAAGTATCCTCTGCTCCTTCGAGAAATCCTGAGGCATACACCAAATGATAACCCAGACCAGCAGCACCTGGAAGAAGCT 

- UNI33878 - ATAAACATCATCCAGGGAATTGTGGCAGAAATCAACACCAAGACTGGGGAATCGGAATGCCGCTATTACAAAGAGCGGCTCCTTTAC

CTGGAAGAAGGCCAGAAAGATTCTCTGATTGACAGCTCAAGGGTCCTGTGTTGTCATGGAGAGCTGAAAAATAACCGGGGTGTG - UNI29421 - AA

ACTCCATGTTTTCCTGTTCCAAGAAGTGCTGGTGATCACCCGAGCTGTCACTCACAACGAGCAGCTCTGCTATCAGTTGTACCGACAGCCCATCCCTGTG

AAGGACCTCACGCTGGAAGACCTGCAGGATGGAGAAGTGCGGCTGGGTGGCTCCCTGCGCGGGGCCTTCAGCAACAACGAGAGAG TTAAAAACTTCTTC

AGAGTCAGTTTCAAAAATGGATCCCAAAGTCAGACCCACTCACTACAAGCCAACGACACCTTCAACAAACAGCAGTGGCTCAACTGTATCCGTCAGGCAA

AAGAAACTGTTCTGTCTGCTGCCGGCCAGGCTGGCTTGCTTGACTCTGAGGGACTGGTCCAGGGTCCCGGCACTGAGAACAGGGAGCCACAGGGAGAAAC

AAAACTTGAGCAGATGGACCAATCGGACAGCGAGTCGGACTGCAGTATGGACACCAGTGAGGTCAGCCTTGAGTGTGAGCGGATGGAACAGACAGACGCT

TCCTGTGCAAACAGCAGGCCCGAGGAGAGTGTCTGACAGAAGACTGTGACCCTGCTAGCAGCAGGCTGTTTCTTACCTGTACAGTGTTTGCATTCCACAC

GTGAACTGTTTGGAGAGGCACTTTGTAATACTCCTGTGCCTGTGTTGGCCTAGTTCCCTCTGTTCCTTGTCCCTAGTACTGTAACTGCCGCTCAGTCTGT

GTCAGCTCACAGCAGTCCTTACCCTGTTGCTGTATCTCACAAGCATCTGGATGAGTGGGGAGGAACTGACCGTGTTACTTTAACTTGTCCTACTTTCAAA

ACAGAAAGGGTCTCTAAACTACTGCTCTGCATGGACTGGGTTGACAAAGCCTTCGTCCCATGCTTCTCTAATGTTCCTCTAGCTCTGACCTAGTAGCTGT

AGTCCTGGCATTGAGAGAGTTTTGCAGAGAACGGAGATGGCATTGGAAGAGAAGGCAGAAAGTCTAATTAATTAACCCTTAGCGTGAGCTCAGGTTCTGT

GTTATTCAACCAGAAAACATGAAAACATCCCTGAGGGTTTCTGAGGTTTAATTTTGCAAAGGAGGAAGCCTTGTTTTGAAGCCTGTGGTTTCATCCAGTG

CAAGTTGAATGTAACAATCTATGAAGACCTGAAACAGAAGTGGCTTTAGAGAGGGCCAAGACAAAAGCAGTTGCCAGACAGGCCTGGTGGCACAGGCCTA

CAAACCTGGCACTTGGGAGCAGAGGCAGGAAGATGTGGAGTTCAAGAACAGCCTTGGCTACATACCAAGTTCTAGTTCAAACTGAGTTCCACAGTATAAA

CAAAACAGAGCTAAAAGCACCTGCCAGCTCTGACTATTCAGCTGAAGTGGGGGACAGCTGTGGGAAGTGTTTGTCATCGCCAGTGGCTTGCCATTAGAAA

AGCCATTTCTAGCCTACGACAACAGAGATTGCCAGGGGCCCGAGAAGATCTGCCAAGGTTATAGGACCCCATCAACCTTATGTTTCATCCACCTCGGCCA

CTCCTCTTTTCTAGTGGAAGACTGTGACTGCACCTGGGACTCTGTTTACAAACAAGAGAGAAGGACTTGGGGGTGAGAAGCGGGTCACTGTCACTGAAGC

CTCCTGTGCAAACCACGGAAACTGAAGTTACTCCGGGCGGTCTCAGGATTTCCTGCTCTGCTTTCAGGCTCTGGTTCTTGAGCTACAGTCAGACTGGTGG

TTAATTCCTCTTGAGGCCAGTTTCATTAGCTCTCATTATCTAGGATCAGCTAGCCAAACTGGAAACTTCTTTGTTCCAGCCTTGATTTACAGAGCAAGGA

TGGGTTCAAACAAACAAACAAACAAACAAACACACACCATGAGGAAAATAAAATGTTCACAAACTAAACAGCTTCTTGCAAGTGTAAATACTTAGGGGAT

TTGTACAAAATTATACCCACACCAGCACTAGTAGTAATGATTCTAAATTATTGCCAAAAAAGTTTTTTGTTGTTGTTAATTTCTGCATCAAGTTTACAGA

AAAGGAAGCAGCAAAATACAAAGTTGTCCCTTTACTGTACACATGGGTCATGTGCATTCAAAGAAGCTGTGAGACAAGAGCAACCAATAGAAAAACAGGT

ATATGACATGGTTATTTTTCAAGACATATTATGATCAGTTCTACCCTGTAAAGCATATTTCTGTATTTATAGATTTTAACAGTGGTGAATTTTTTTCTAT

TACAAGTTTATTTAAAACCATTTTGTTTCCCAAGTTGCTGAATAAACAAACCTGCTCCAGGCAGACACAGTGGAAAGCTGAGACAGGACACTGGATGATG

GAGAAAGCTTCAACTGTTCTCTGTAGAGCCGCTGGCCACGGTGGCCAGTGAGTCAAGGTCTGTCAGCCTGTGGGAAGAGAGTGGACGGATGTTTTGGTGA

AATGAATACTTTTGTATAATGGCCTTAAACTTTTCTGGAAGCATTTCAAATAAATTGCATT
Translation
MVAKDYPFYLTVKRANCSLEAPLGSGVAKDE - UNI25304 - EPSNKRVKPLSRVTSLANLIPPVKTTPLKRFSQTLQ - UNI32773 - RSISF

RSESRPDILAPRAWSRNATSSSTKRRDSKLWSETFDVCVNQVLTAKEIKRQE AIFELSQGEEDLIEDLKLAKK AYHDPMLKLSIMTEQELNQIFGTLD

SLIPLHEE ELLSQLRDVRKPDGSTEHVGPILVGW LPCLSSYDSYCSNQVAAKALLDHKKQDHRVQDFLQRCLESPFSRKLDLWNFLDIPRSRLVKYPL

LLREILRHTPNDNPDQQHLEEA - UNI33878 - INIIQGIVAEINTKTGESECRYYKERLLYLEEGQKDSLIDSSRVLCCHGELKNNRGV - UNI2

9421 - KLHVFLFQEVLVITRAVTHNEQLCYQLYRQPIPVKDLTLEDLQDGEVRLGGSLRGAFSNNERV VKNFFRVSFKNGSQSQTHSLQANDTFNKQ

QWLNCIRQAKETVLSAAGQAGLLDSEGLVQGPGTENREPQGETKLEQMDQSDSESDCSMDTSEVSLECERMEQTDASCANSRPEESV
Transcript ENSMUST00000049206
Sequence
ACACAGCTCCGAGCCTCCTGTCCACCAGGCTCTGCTGCACTTAGCAGCCAGGGAATTGGGGTGGATGAGGTCGGAGCGCCCCATGGTGTGGTGCTGTTTT

TTTCTCCGTGCACAG - UNI35129 - CGGAAACGAAAACAGAGTTCCCAGGATGAAGATGCTGTCAGCCTGTGCAGTCTTGACATAAGT - UNI81

36 - - UNI25304 - GAACCTAGTAACAAAAGGGTCAAACCCCTTTCCAGAGTCACATCGCTAGCAAACCTCATTCCACCTGTGAAGACCACACCAT

TAAAGCGCTTCAGCCAGACCTTGCAG - UNI32773 - CGGTCCATCAGCTTCCGCAGCGAGAGCCGCCCCGACATCCTTGCCCCCCGAGCTTGGTCC

AGAAATGCCACCTCCTCAAGCACAAAGCGGAGAGACAGCAAACTGTGGAGTGAGACCTTCGATGTGTGTGTCAATCAGGTGCTCACGGCCAAGGAGATCA

AGAGACAGGAG GCGATCTTTGAACTTTCTCAAGGTGAAGAAGACTTGATAGAGGACTTGAAATTAGCAAAAAAG GCCTACCACGACCCCATGCTGAAA

CTCTCCATAATGACGGAACAGGAACTGAATCAGATTTTTGGGACCCTGGACTCTCTAATTCCTCTCCATGAAG AGCTCCTCAGTCAGCTTCGAGATGTT

CGGAAACCCGATGGCTCGACTGAGCACGTTGGTCCCATCCTCGTGGGCTGG CTGCCCTGTCTCAGCTCCTACGACAGCTACTGCAGCAATCAAGTCGCC

GCCAAAGCCCTGCTGGACCACAAAAAGCAGGACCACAGAGTGCAGGACTTCCTCCAGCGCTGTTTAGAATCACCCTTCAGTCGCAAACTCGATCTCTGGA

ATTTCCTTGATATTCCCCGGAGCCGGCTAGTGAAGTATCCTCTGCTCCTTCGAGAAATCCTGAGGCATACACCAAATGATAACCCAGACCAGCAGCACCT

GGAAGAAGCT - UNI33878 - ATAAACATCATCCAGGGAATTGTGGCAGAAATCAACACCAAGACTGGGGAATCGGAATGCCGCTATTACAAAGAGC

GGCTCCTTTACCTGGAAGAAGGCCAGAAAGATTCTCTGATTGACAGCTCAAGGGTCCTGTGTTGTCATGGAGAGCTGAAAAATAACCGGGGTGTG - UN

I29421 - AAACTCCATGTTTTCCTGTTCCAAGAAGTGCTGGTGATCACCCGAGCTGTCACTCACAACGAGCAGCTCTGCTATCAGTTGTACCGACAGC

CCATCCCTGTGAAGGACCTCACGCTGGAAGACCTGCAGGATGGAGAAGTGCGGCTGGGTGGCTCCCTGCGCGGGGCCTTCAGCAACAACGAGAGAG TTA

AAAACTTCTTCAGAGTCAGTTTCAAAAATGGATCCCAAAGTCAGACCCACTCACTACAAGCCAACGACACCTTCAACAAACAGCAGTGGCTCAACTGTAT

CCGTCAGGCAAAAGAAACTGTTCTGTCTGCTGCCGGCCAGGCTGGCTTGCTTGACTCTGAGGGACTGGTCCAGGGTCCCGGCACTGAGAACAGGGAGCCA

CAGGGAGAAACAAAACTTGAGCAGATGGACCAATCGGACAGCGAGTCGGACTGCAGTATGGACACCAGTGAGGTCAGCCTTGAGTGTGAGCGGATGGAAC

AGACAGACGCTTCCTGTGCAAACAGCAGGCCCGAGGAGAGTGTCTGACAGAAGACTGTGACCCTGCTAGCAGCAGGCTGTTTCTTACCTGTACAGTGTTT

GCATTCCACACGTGAACTGTTTGGAGAGGCACTTTGTAATACTCCTGTGCCTGTGTTGGCCTAGTTCCCTCTGTTCCTTGTCCCTAGTACTGTAACTGCC

GCTCAGTCTGTGTCAGCTCACAGCAGTCCTTACCCTGTTGCTGTATCTCACAAGCATCTGGATGAGTGGGGAGGAACTGACCGTGTTACTTTAACTTGTC

CTACTTTCAAAACAGAAAGGGTCTCTAAACTACTGCTCTGCATGGACTGGGTTGACAAAGCCTTCGTCCCATGCTTCTCTAATGTTCCTCTAGCTCTGAC

CTAGTAGCTGTAGTCCTGGCATTGAGAGAGTTTTGCAGAGAACGGAGATGGCATTGGAAGAGAAGGCAGAAAGTCTAATTAATTAACCCTTAGCGTGAGC

TCAGGTTCTGTGTTATTCAACCAGAAAACATGAAAACATCCCTGAGGGTTTCTGAGGTTTAATTTTGCAAAGGAGGAAGCCTTGTTTTGAAGCCTGTGGT

TTCATCCAGTGCAAGTTGAATGTAACAATCTATGAAGACCTGAAACAGAAGTGGCTTTAGAGAGGGCCAAGACAAAAGCAGTTGCCAGACAGGCCTGGTG

GCACAGGCCTACAAACCTGGCACTTGGGAGCAGAGGCAGGAAGATGTGGAGTTCAAGAACAGCCTTGGCTACATACCAAGTTCTAGTTCAAACTGAGTTC

CACAGTATAAACAAAACAGAGCTAAAAGCACCTGCCAGCTCTGACTATTCAGCTGAAGTGGGGGACAGCTGTGGGAAGTGTTTGTCATCGCCAGTGGCTT

GCCATTAGAAAAGCCATTTCTAGCCTACGACAACAGAGATTGCCAGGGGCCCGAGAAGATCTGCCAAGGTTATAGGACCCCATCAACCTTATGTTTCATC

CACCTCGGCCACTCCTCTTTTCTAGTGGAAGACTGTGACTGCACCTGGGACTCTGTTTACAAACAAGAGAGAAGGACTTGGGGGTGAGAAGCGGGTCACT

GTCACTGAAGCCTCCTGTGCAAACCACGGAAACTGAAGTTACTCCGGGCGGTCTCAGGATTTCCTGCTCTGCTTTCAGGCTCTGGTTCTTGAGCTACAGT

CAGACTGGTGGTTAATTCCTCTTGAGGCCAGTTTCATTAGCTCTCATTATCTAGGATCAGCTAGCCAAACTGGAAACTTCTTTGTTCCAGCCTTGATTTA

CAGAGCAAGGATGGGTTCAAACAAACAAACAAACAAACAAACACACACCATGAGGAAAATAAAATGTTCACAAACTAAACAGCTTCTTGCAAGTGTAAAT

ACTTAGGGGATTTGTACAAAATTATACCCACACCAGCACTAGTAGTAATGATTCTAAATTATTGCCAAAAAAGTTTTTTGTTGTTGTTAATTTCTGCATC

AAGTTTACAGAAAAGGAAGCAGCAAAATACAAAGTTGTCCCTTTACTGTACACATGGGTCATGTGCATTCAAAGAAGCTGTGAGACAAGAGCAACCAATA

GAAAAACAGGTATATGACATGGTTATTTTTCAAGACATATTATGATCAGTTCTACCCTGTAAAGCATATTTCTGTATTTATAGATTTTAACAGTGGTGAA

TTTTTTTCTATTACAAGTTTATTTAAAACCATTTTGTTTCCCAAGTTGCTGAATAAACAAACCTGCTCCAGGCAGACACAGTGGAAAGCTGAGACAGGAC

ACTGGATGATGGAGAAAGCTTCAACTGTTCTCTGTAGAGCCGCTGGCCACGGTGGCCAGTGAGTCAAGGTCTGTCAGCCTGTGGGAAGAGAGTGGACGGA

TGTTTTGGTGAAATGAATACTTTTGTATAATGGCCTTAAACTTTTCTGGAAGCATTTCAAATAAATTGCATT
Translation
MRSERPMVWCCFFLRAQ - UNI35129 - RKRKQSSQDEDAVSLCSLDIS - UNI8136 - - UNI25304 - EPSNKRVKPLSRVTSLANLIPP

VKTTPLKRFSQTLQ - UNI32773 - RSISFRSESRPDILAPRAWSRNATSSSTKRRDSKLWSETFDVCVNQVLTAKEIKRQE AIFELSQGEEDLIE

DLKLAKK AYHDPMLKLSIMTEQELNQIFGTLDSLIPLHEE ELLSQLRDVRKPDGSTEHVGPILVGW LPCLSSYDSYCSNQVAAKALLDHKKQDHRVQ

DFLQRCLESPFSRKLDLWNFLDIPRSRLVKYPLLLREILRHTPNDNPDQQHLEEA - UNI33878 - INIIQGIVAEINTKTGESECRYYKERLLYLE

EGQKDSLIDSSRVLCCHGELKNNRGV - UNI29421 - KLHVFLFQEVLVITRAVTHNEQLCYQLYRQPIPVKDLTLEDLQDGEVRLGGSLRGAFSNN

ERV VKNFFRVSFKNGSQSQTHSLQANDTFNKQQWLNCIRQAKETVLSAAGQAGLLDSEGLVQGPGTENREPQGETKLEQMDQSDSESDCSMDTSEVSLE

CERMEQTDASCANSRPEESV

For any suggestions or comments, please send an email to unitrap@crg.es