Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000021905 (Dph3)
Chromosomal location
Chr 14: 32893748 - 32898851 (-)
Description
DPH3 homolog (KTI11, S. cerevisiae) Gene [Source:MGI (curated);Acc:Dph3-001]
RefSeq_dna
NM_001047433 NM_172254 
RefSeq_peptide
NP_758458.1 NP_001040898.1 
UniGene
Mm.2519 
MGI
MGI:1922658 
Uniprot/SWISSPROT
Q8K0W9 
Human Ortholog
ENSG00000154813 (ZCSL2)
Omim not available
UniTrap UNI23247
Vector Insertion
Chr 14: 32898092 - 32898168
Public Clones not available
Private Clones OST269593 (lexicon)
Severity of mutation (?) Insertion after 49% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI38387
Vector Insertion
Chr 14: 32898092 - 32898796
Public Clones (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 49% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI29128
Vector Insertion
Chr 14: 32896433 - 32897881
Public Clones IST14913B1 (tigm)
Private Clones OST7682 (lexicon)
Severity of mutation (?) Insertion after 63% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI13971
Vector Insertion
Chr 14: 32896354 - 32896433
Public Clones CMHD-GT_178D7-3 (cmhd)
Private Clones OST274125 (lexicon) OST220445 (lexicon) OST68275 (lexicon)
Severity of mutation (?) Insertion after 63% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000112000
Sequence
GACTGTTCCTGCGCCAGGGTGGACCGGGAAGACCGGGCCTTACCCTGCCTGGGCGCAGGTAGGCAAGCTGATGCGGTGCCGACCGGGTGACCATGGCGGT

GTTTCACGACGAGGTGGAGATCGAGGACTTTCAATATGACGAGGACTCGGAGACATATTTCTACCCTTGCCCCTGTGGGGATAACTTTGCCATCACCAAG

 - UNI23247 - GAAGATTTGGAAAATGGAGAAGATGTGGCCACGTGTCCTAGCTGCTCACTCATTATAAAAGTGATTTATGACAAAGTAAGGGATAT

GTTAAAGGGGATGGGTGGTGTGAGCTAATGACAAGGGCCTAAAGGAGCCTGTCTGATAGAAAAGGGCGGAAGAGTGTTGGGTGTTGGTTTGTTTTTTGAG

ACAGGGACCTTAAGTAGCCCTGGCTATACTGGAACTCATGATGTGAACCAGGCTGGCCTTGAATTCACAGAGATCTGCCTTTTATGTAACTTATGATCAC

Translation
MAVFHDEVEIEDFQYDEDSETYFYPCPCGDNFAITK - UNI23247 - EDLENGEDVATCPSCSLIIKVIYDKVRDMLKGMGGVS
Transcript ENSMUST00000022461
Sequence
GACTGTTCCTGCGCCAGGGTGGACCGGGAAGACCGGGCCTTACCCTGCCTGGGCGCAGGTAGGCAAGCTGATGCGGTGCCGACCGGGTGACCATGGCGGT

GTTTCACGACGAGGTGGAGATCGAGGACTTTCAATATGACGAGGACTCGGAGACATATTTCTACCCTTGCCCCTGTGGGGATAACTTTGCCATCACCAAG

 - UNI23247 - GAAGATTTGGAAAATGGAGAAGATGTGGCCACGTGTCCTAGCTGCTCACTCATTATAAAAGTGATTTATGACAAA - UNI13971

 - - UNI23247 - - UNI29128 - GATCAGTTCATGTGTGGAGAAACAGTCCCAGCACCTTCAACCAACAAGGAGTTAGTTAAATGCTGAAGAGG

CTCTCAG - UNI13971 - AATGAAGCTACTGCTCAGACGGGCAGAGCAAGGTGATTCTGGGGAGGAGGAGCTGCCTGGGGAAACAGATGGTCTGTGC

TCATGAGAGCGATGCTTTTGGAGATCTCACCAGCAGTCTCTGCTGCTGCGGTTGCTGCTGTATTCCACAGCAGACGTCTTCTGTGATCACAATGGAGCAG

GAGTCCACATTCAAACGGCCCAGGAGAGAGAGAGCGCGAACAGACCGGGGATGAGTGCCTGGTAGGAGCGGGTGTGACTTTGTATTTAAAGCAACCAAGC

AAGTTTATAAACTAGAAGAAATACCAGCTATTAACCCCGTATTAAACAGAAAAACCCAAGGTCATTCAGATGTGACTGGAATCCCAGACGTTTCCAGAGT

ACTCAGCTGACAGTTGGCATTTCAGATGTGATTCCTTGTCAGACCTTTTGTCAACCCAAAACTATGAGTGGACGCTTCATTTTCTTTCACAGCATCGCAC

TTTAGAGTGGAAAGTTTCTAGTTCAAAGGATCCTTTCCTTTCCTGCGAGTGCTTTCTCCCCCGAGGACTTTGAACTTGGGACTCCTCCTTTGTGTTCACA

GAAGACCTACATCAATATATTCACATCTGCATTCAGACACAGCCAACAATTTTTTTTTAGTACTGCGTGGATCAGTTCATTAGAACGACTTGCATTGCCA

AGCTAATAAAATGAGAACATGCAAA
Translation
MAVFHDEVEIEDFQYDEDSETYFYPCPCGDNFAITK - UNI23247 - EDLENGEDVATCPSCSLIIKVIYDK - UNI13971 - - UNI23247 

- - UNI29128 - DQFMCGETVPAPSTNKELVKC - UNI13971 - 
Transcript ENSMUST00000112001
Sequence
GTCACCCTTTTGGCCGCGGCGGTAGAAGTTACGTCATCGCCTGTGCGTCCGGAAGTGACTGTTCCTGCGCCAGGGTGGACCGGGAAGACCGGGCCTTACC

CTGCCTGGGCGCAGGTAGGCAAGCTGATGCGGTGCCGACCGGGTGACCATGGCGGTGTTTCACGACGAGGTGGAGATCGAGGACTTTCAATATGACGAGG

ACTCGGAGACATATTTCTACCCTTGCCCCTGTGGGGATAACTTTGCCATCACCAAG - UNI13971 - - UNI23247 - - UNI29128 - GATC

AGTTCATGTGTGGAGAAACAGTCCCAGCACCTTCAACCAACAAGGAGTTAGTTAAATGCTGAAGAGGCTCTCAGGTACCCACATCCTGAACCGTGGGGGC

TGAGCCCAGGTGGATGGATCCAGTGCAGAGTTACCAACCTCCTCGATGGGCAGCCTCAGGGGTGTGATCTTCATCAGCCACTGAACTCAGCATGAAAAAG

GGAGCCTATGACATGCCAGCCCTGGATTCCATACTGGGACTGGAAGGATTCCTAATTGTCCGTCTGAATTTAAGGAAGAGCCTTATTATAAACTGTGGTT

TTTCCTTCAGTCGGCTGCATCATTTGAACATCTGGAAATTCATTTTCTGAAAATAACATCATCCGCCTCAATCCTGAGTGTCTTTTATTTTTTTAAGATT

TATTATTTTATTCTTAATTGTGTGTGTATGTGCATTTGTGTGTGGGTACGTGCATATGAGTACCGTTGCCCAAGATGGATCTCCTGGAGCAGGAGTCCCA

GGCAGTTGGGAGCCACCTGACGTGGATGCTGGGACCCAAACTTTGGTTCCCTGAAAGCACTACACATTCCTAACCTTGGAACCATCTTTCCAGCCCGTGA

TGGGAGCTTTTCAAAGATTACATTTTGACATAGTTTCTGAGGTGGTTCAGGTGAGGCCTTTCCTAGAAACATCTGCCTTTTCCAGAGCTGCACTTGCGGC

TCATTCATCAGCCAGCCACCTAGGCTTGCCGTGACTGCGTTGTTCCTGTTCTCAGTCATTTCTGTTACTTTTCACGCGCCAAGTGCAGTCCTGGTATTAG

ACCGTAAGACCACAGTTTCTCTGTAGCTTCCAGTTAGTGAGGAAGGAGGGACGTCTGAAGTGACTTAGTAAAAGAGACACTGTTCTTTAATGCCTCGTGC

ATCCTTATGTCAGGACAGGTTAAAAGGAAACAGCCAAGTGAGGTACCTTAGCTGGCAGCAGCGCGAGGCGTGAAGCCTGCTAACTTGCCAAGTGAAAGTG

CGTGAGTATTGCCAGCTGGAAACAAGTATTTCTGTATCAGGGCCTTTATTTCTTGAAAGGCCTGATGGGTTCATCTTAGACGGGCGAGGCTGATCCTATC

TGTAGTGGTTGTAACGGGGCACAGTTTTGTGTCACCGTTAGTCTTAAGAAGTGCAGACGCTACAACAGGATGAGCTTGGAAGTGTGAGCTGGCTCTAAGA

CATGCCTGTGATGGCACACCTAGGAAGACTGCACATAACGGTACCCAAATCAGACATGCACCCCCGCTGCCCTGAAAAAAAGAAATATATGTCAAGAATG

ACTGTCTGCACTGCAGTCTGAGAGCATCCAGACGTTAGACTCAGTCAGAGGTTTGAAAGTTCTTTTGTAAACAGCTTTGCTGTGAATACGTAAAATACTT

TTGAAAGTCCACCGCTTATCCAGCAGAGTGTTTGGGATATGGCTGCTGCAACTGAAAACAAGCCAGTAGGGGCTGGAGAGATGGCTCATGGGTTAAGAGT

TCTTGCTGTTCTTCTAGAGGACCGGTGTTCAATTCTTAGCACCCACATAGCAGCTCACAACTATCTGGGGCTCCAGTTCCTGGGACTCTGATGCCCTCTT

CTGCCCTCCATAAATACCAGGCATGCACATAGTTTACAGACATACATGCAGACAAAAGACCCATACAACTAAGTAATAATTTTTTTAAAAAAAGAAATGG

CTAATAAATACATTGTATCCACTCATTGAAGGTTTGAATTAAAATATGTAACAGTGTATGGTTCTAGGCAGCCATTAGGCTGAGACTTAAGTTAAAAGTT

GTCTGAAGTGTGTTGTACAGTACATGTCAGATTTCTTCCTTTGTTTGTGGGAGGTGGGAAGGCATTGAACCCAGAGCCTTGCTCACGCCGGGCAAGCCCT

CCAGTACTGGGCTGCACCTTCAGCCAGCATAGTTTTCATACTGCTGTTTGGTGTCTCCCAAATTATCTTACAGAATGAAGCTACTGCTCAGACGGGCAGA

GCAAGGTGATTCTGGGGAGGAGGAGCTGCCTGGGGAAACAGATGGTCTGTGCTCATGAGAGCGATGCTTTTGGAGATCTCACCAGCAGTCTCTGCTGCTG

CGGTTGCTGCTGTATTCCACAGCAGACGTCTTCTGTGATCACAATGGAGCAGGAGTCCACATTCAAACGGCCCAGGAGAGAGAGAGCGCGAACAGACCGG

GGATGAGTGCCTGGTAGGAGCGGGTGTGACTTTGTATTTAAAGCAACCAAGCAAGTTTATAAACTAGAAGAAATACCAGCTATTAACCCCGTATTAAACA

GAAAAACCCAAGGTCATTCAGATGTGACTGGAATCCCAGACGTTTCCAGAGTACTCAGCTGACAGTTGGCATTTCAGATGTGATTCCTTGTCAGACCTTT

TGTCAACCCAAAACTATGAGTGGACGCTTCATTTTCTTTCACAGCATCGCACTTTAGAGTGGAAAGTTTCTAGTTCAAAGGATCCTTTCCTTTCCTGCGA

GTGCTTTCTCCCCCGAGGACTTTGAACTTGGGACTCCTCCTTTGTGTTCACAGAAGACCTACATCAATATATTCACATCTGCATTCAGACACAGCCAACA

ATTTTTTTTTAGTACTGCGTGGATCAGTTCATTAGAACGACTTGCATTGCCAAGCTAATAAAATGAGAACATGCAAATTCA
Translation
MAVFHDEVEIEDFQYDEDSETYFYPCPCGDNFAITK - UNI13971 - - UNI23247 - - UNI29128 - DQFMCGETVPAPSTNKELVKC
Transcript ENSMUST00000067955
Sequence
GTCACCCTTTTGGCCGCGGCGGTAGAAGTTACGTCATCGCCTGTGCGTCCGGAAGTGACTGTTCCTGCGCCAGGGTGGACCGGGAAGACCGGGCCTTACC

CTGCCTGGGCGCAGGTAGGCAAGCTGATGCGGTGCCGACCGGGTGACCATGGCGGTGTTTCACGACGAGGTGGAGATCGAGGACTTTCAATATGACGAGG

ACTCGGAGACATATTTCTACCCTTGCCCCTGTGGGGATAACTTTGCCATCACCAAG - UNI23247 - GAAGATTTGGAAAATGGAGAAGATGTGGCC

ACGTGTCCTAGCTGCTCACTCATTATAAAAGTGATTTATGACAAA - UNI13971 - - UNI23247 - - UNI29128 - GATCAGTTCATGTGT

GGAGAAACAGTCCCAGCACCTTCAACCAACAAGGAGTTAGTTAAATGCTGAAGAGGCTCTCAGGTACCCACATCCTGAACCGTGGGGGCTGAGCCCAGGT

GGATGGATCCAGTGCAGAGTTACCAACCTCCTCGATGGGCAGCCTCAGGGGTGTGATCTTCATCAGCCACTGAACTCAGCATGAAAAAGGGAGCCTATGA

CATGCCAGCCCTGGATTCCATACTGGGACTGGAAGGATTCCTAATTGTCCGTCTGAATTTAAGGAAGAGCCTTATTATAAACTGTGGTTTTTCCTTCAGT

CGGCTGCATCATTTGAACATCTGGAAATTCATTTTCTGAAAATAACATCATCCGCCTCAATCCTGAGTGTCTTTTATTTTTTTAAGATTTATTATTTTAT

TCTTAATTGTGTGTGTATGTGCATTTGTGTGTGGGTACGTGCATATGAGTACCGTTGCCCAAGATGGATCTCCTGGAGCAGGAGTCCCAGGCAGTTGGGA

GCCACCTGACGTGGATGCTGGGACCCAAACTTTGGTTCCCTGAAAGCACTACACATTCCTAACCTTGGAACCATCTTTCCAGCCCGTGATGGGAGCTTTT

CAAAGATTACATTTTGACATAGTTTCTGAGGTGGTTCAGGTGAGGCCTTTCCTAGAAACATCTGCCTTTTCCAGAGCTGCACTTGCGGCTCATTCATCAG

CCAGCCACCTAGGCTTGCCGTGACTGCGTTGTTCCTGTTCTCAGTCATTTCTGTTACTTTTCACGCGCCAAGTGCAGTCCTGGTATTAGACCGTAAGACC

ACAGTTTCTCTGTAGCTTCCAGTTAGTGAGGAAGGAGGGACGTCTGAAGTGACTTAGTAAAAGAGACACTGTTCTTTAATGCCTCGTGCATCCTTATGTC

AGGACAGGTTAAAAGGAAACAGCCAAGTGAGGTACCTTAGCTGGCAGCAGCGCGAGGCGTGAAGCCTGCTAACTTGCCAAGTGAAAGTGCGTGAGTATTG

CCAGCTGGAAACAAGTATTTCTGTATCAGGGCCTTTATTTCTTGAAAGGCCTGATGGGTTCATCTTAGACGGGCGAGGCTGATCCTATCTGTAGTGGTTG

TAACGGGGCACAGTTTTGTGTCACCGTTAGTCTTAAGAAGTGCAGACGCTACAACAGGATGAGCTTGGAAGTGTGAGCTGGCTCTAAGACATGCCTGTGA

TGGCACACCTAGGAAGACTGCACATAACGGTACCCAAATCAGACATGCACCCCCGCTGCCCTGAAAAAAAGAAATATATGTCAAGAATGACTGTCTGCAC

TGCAGTCTGAGAGCATCCAGACGTTAGACTCAGTCAGAGGTTTGAAAGTTCTTTTGTAAACAGCTTTGCTGTGAATACGTAAAATACTTTTGAAAGTCCA

CCGCTTATCCAGCAGAGTGTTTGGGATATGGCTGCTGCAACTGAAAACAAGCCAGTAGGGGCTGGAGAGATGGCTCATGGGTTAAGAGTTCTTGCTGTTC

TTCTAGAGGACCGGTGTTCAATTCTTAGCACCCACATAGCAGCTCACAACTATCTGGGGCTCCAGTTCCTGGGACTCTGATGCCCTCTTCTGCCCTCCAT

AAATACCAGGCATGCACATAGTTTACAGACATACATGCAGACAAAAGACCCATACAACTAAGTAATAATTTTTTTAAAAAAAGAAATGGCTAATAAATAC

ATTGTATCCACTCATTGAAGGTTTGAATTAAAATATGTAACAGTGTATGGTTCTAGGCAGCCATTAGGCTGAGACTTAAGTTAAAAGTTGTCTGAAGTGT

GTTGTACAGTACATGTCAGATTTCTTCCTTTGTTTGTGGGAGGTGGGAAGGCATTGAACCCAGAGCCTTGCTCACGCCGGGCAAGCCCTCCAGTACTGGG

CTGCACCTTCAGCCAGCATAGTTTTCATACTGCTGTTTGGTGTCTCCCAAATTATCTTACAGAATGAAGCTACTGCTCAGACGGGCAGAGCAAGGTGATT

CTGGGGAGGAGGAGCTGCCTGGGGAAACAGATGGTCTGTGCTCATGAGAGCGATGCTTTTGGAGATCTCACCAGCAGTCTCTGCTGCTGCGGTTGCTGCT

GTATTCCACAGCAGACGTCTTCTGTGATCACAATGGAGCAGGAGTCCACATTCAAACGGCCCAGGAGAGAGAGAGCGCGAACAGACCGGGGATGAGTGCC

TGGTAGGAGCGGGTGTGACTTTGTATTTAAAGCAACCAAGCAAGTTTATAAACTAGAAGAAATACCAGCTATTAACCCCGTATTAAACAGAAAAACCCAA

GGTCATTCAGATGTGACTGGAATCCCAGACGTTTCCAGAGTACTCAGCTGACAGTTGGCATTTCAGATGTGATTCCTTGTCAGACCTTTTGTCAACCCAA

AACTATGAGTGGACGCTTCATTTTCTTTCACAGCATCGCACTTTAGAGTGGAAAGTTTCTAGTTCAAAGGATCCTTTCCTTTCCTGCGAGTGCTTTCTCC

CCCGAGGACTTTGAACTTGGGACTCCTCCTTTGTGTTCACAGAAGACCTACATCAATATATTCACATCTGCATTCAGACACAGCCAACAATTTTTTTTTA

GTACTGCGTGGATCAGTTCATTAGAACGACTTGCATTGCCAAGCTAATAAAATGAGAACATGCAAATTCA
Translation
MAVFHDEVEIEDFQYDEDSETYFYPCPCGDNFAITK - UNI23247 - EDLENGEDVATCPSCSLIIKVIYDK - UNI13971 - - UNI23247 

- - UNI29128 - DQFMCGETVPAPSTNKELVKC

For any suggestions or comments, please send an email to unitrap@crg.es