Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000021929 (Kpna3)
Chromosomal location
Chr 14: 61984023 - 62058711 (-)
Description
karyopherin (importin) alpha 3 Gene [Source:MGI Symbol;Acc:MGI:1100863]
RefSeq_dna
NM_008466 
RefSeq_peptide
NP_032492.1 
UniGene
Mm.25548 Mm.474026 
MGI
MGI:1100863 
Uniprot/SWISSPROT
O35344 
Uniprot/SPTREMBL
Q9CT07 Q543M7 
Human Ortholog
ENSG00000102753 (KPNA3)
Omim not available
UniTrap UNI7055
Vector Insertion
Chr 14: 62021880 - 62058559
Public Clones RRY470 (baygenomics) RRY441 (baygenomics)
Private Clones OST342752 (lexicon) OST314774 (lexicon) OST284391 (lexicon)
Severity of mutation (?) Insertion after 7% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI2914
Vector Insertion
Chr 14: 62010683 - 62021834
Public Clones AD0533 (sanger) D145C12 (ggtc)
Private Clones OST147796 (lexicon)
Severity of mutation (?) Insertion after 11% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI23312
Vector Insertion
Chr 14: 62010415 - 62010592
Public Clones not available
Private Clones OST265348 (lexicon)
Severity of mutation (?) Insertion after 20% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI4048
Vector Insertion
Chr 14: 62006347 - 62010000
Public Clones AQ0326 (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 38% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI4046
Vector Insertion
Chr 14: 62003595 - 62003939
Public Clones AQ0328 (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 55% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI4051
Vector Insertion
Chr 14: 62002117 - 62003424
Public Clones AQ0317 (sanger) AQ0313 (sanger) RRS272 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 72% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI2155
Vector Insertion
Chr 14: 61991248 - 61991822
Public Clones XT0659 (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 66% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI5468
Vector Insertion
Chr 14: 61987060 - 61989219
Public Clones CSJ322 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 100% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000053719
Sequence
GCGCGCTCCTCCCCCTTCGTCCCCTCCCGCTCGACTCGCCGCCGCCGCCGCAGGAGCAGACGCCTCCGGAGCCGCGCGCAGCCATGGCCGAGAACCCCGG

CTTGGAGAACCACCGCATCAAGAGCTTCAAGAACAAGGGCCGCGATGTGGAG - UNI7055 - ACGATGCGAAGACACAGAAATGAAGTGACAGTTGA

ACTCCGGAAG - UNI2914 - AACAAAAGAGACGAACACTTACTGAAAAAGAGAAATGTTCCCCAAGAAGAAAGCTTAGAAGATTCAGATGTTGATGC

TGATTTTAAAGCA - UNI23312 - CAAAATGTAACACTAGAAGCTATATTACAG AATGCCACAAGTGATAATCCTGTAGTCCAGTTGAGTGCTGTG

CAGGCAGCAAG GAAACTATTATCCAGTGACAGAAATCCACCAATTGATGACCTAATAAAATCTGGGATTTTACCAATTCTAGTCAAATGTCTAGAAAGA

GATGATAA - UNI4048 - TCCTTCATTACAGTTTGAAGCTGCTTGGGCACTAACTAATATAGCATCGGGAACTTCTGCACAGACTCAAGCTGTTGTA

CAGTCTA ATGCAGTACCACTTTTTCTGCGACTCCTCCATTCCCCACATCAGAATGTTTGTGAACAAGCGGTGTGGGCTTTGGGAAACATTATAG - UN

I4046 - GTGATGGTCCTCAATGTAGAGATTATGTCATATCACTGGGAGTTGTCAAACCTCTTCTGTCCTTCATCAATCCCTCCATTCCCATCACCTTC

CTTCGGAACGTCACATGGGTCATTGTCAATCTCTGCAGGAATAAAGACCCCCCACCGCCTATGGAGACAGTTCAGGAG - UNI4051 - ATTTTGCCA

GCTTTGTGTGTGCTCATCTACCATACGGACATAAAT ATTCTTGTAGACACTGTTTGGGCGCTGTCATACTTGACAGACGGGGGAAATGAGCAAATACAG

ATGGTTATTGATTCAGGGGTTGTACCCTTCCTCGTACCCCTTCTGAGCCACCAGGAAGTCAAAGTTCAA ACTGCAGCACTCAGAGCGGTTGGGAACATA

GTGACTGGCACT AGCAGACCCAGGTGGTTCTCAACTGTGATGTCCTGTCCCACTTCCCAAACCTCTT - UNI2155 - TTACTCCC
Translation
MAENPGLENHRIKSFKNKGRDVE - UNI7055 - TMRRHRNEVTVELRK - UNI2914 - NKRDEHLLKKRNVPQEESLEDSDVDADFKA - UNI

23312 - QNVTLEAILQ NATSDNPVVQLSAVQAAR RKLLSSDRNPPIDDLIKSGILPILVKCLERDDN - UNI4048 - NPSLQFEAAWALTNIA

SGTSAQTQAVVQSN NAVPLFLRLLHSPHQNVCEQAVWALGNIIG - UNI4046 - GDGPQCRDYVISLGVVKPLLSFINPSIPITFLRNVTWVIVNL

CRNKDPPPPMETVQE - UNI4051 - ILPALCVLIYHTDIN ILVDTVWALSYLTDGGNEQIQMVIDSGVVPFLVPLLSHQEVKVQ TAALRAVGNIV

TGT SRPRWFSTVMSCPTSQTSF - UNI2155 - FTP
Transcript ENSMUST00000022496
Sequence
GCGCGCTCCTCCCCCTTCGTCCCCTCCCGCTCGACTCGCCGCCGCCGCCGCAGGAGCAGACGCCTCCGGAGCCGCGCGCAGCCATGGCCGAGAACCCCGG

CTTGGAGAACCACCGCATCAAGAGCTTCAAGAACAAGGGCCGCGATGTGGAG - UNI7055 - ACGATGCGAAGACACAGAAATGAAGTGACAGTTGA

ACTCCGGAAG - UNI2914 - AACAAAAGAGACGAACACTTACTGAAAAAGAGAAATGTTCCCCAAGAAGAAAGCTTAGAAGATTCAGATGTTGATGC

TGATTTTAAAGCA - UNI23312 - CAAAATGTAACACTAGAAGCTATATTACAG AATGCCACAAGTGATAATCCTGTAGTCCAGTTGAGTGCTGTG

CAGGCAGCAAG GAAACTATTATCCAGTGACAGAAATCCACCAATTGATGACCTAATAAAATCTGGGATTTTACCAATTCTAGTCAAATGTCTAGAAAGA

GATGATAA - UNI4048 - TCCTTCATTACAGTTTGAAGCTGCTTGGGCACTAACTAATATAGCATCGGGAACTTCTGCACAGACTCAAGCTGTTGTA

CAGTCTA ATGCAGTACCACTTTTTCTGCGACTCCTCCATTCCCCACATCAGAATGTTTGTGAACAAGCGGTGTGGGCTTTGGGAAACATTATAG - UN

I4046 - GTGATGGTCCTCAATGTAGAGATTATGTCATATCACTGGGAGTTGTCAAACCTCTTCTGTCCTTCATCAATCCCTCCATTCCCATCACCTTC

CTTCGGAACGTCACATGGGTCATTGTCAATCTCTGCAGGAATAAAGACCCCCCACCGCCTATGGAGACAGTTCAGGAG - UNI4051 - ATTTTGCCA

GCTTTGTGTGTGCTCATCTACCATACGGACATAAAT ATTCTTGTAGACACTGTTTGGGCGCTGTCATACTTGACAGACGGGGGAAATGAGCAAATACAG

ATGGTTATTGATTCAGGGGTTGTACCCTTCCTCGTACCCCTTCTGAGCCACCAGGAAGTCAAAGTTCAA ACTGCAGCACTCAGAGCGGTTGGGAACATA

GTGACTGGCACTGATGAGCAGACCCAGGTGGTTCTCAACTGTGATGTCCTGTCCCACTTCCCAAACCTCTTGTCACACCCAAAAGAGAAAATAAATAAG 

- UNI2155 - GAAGCAGTATGGTTCCTTTCCAATATAACAGCAGGCAATCAGCAGCAAGTTCAAGCTGTAATAGATGCTGGGTTAATCCCTATGATTA

TTCATCAGCTCGCTAAG GGGGACTTTGGAACACAAAAGGAAGCTGCTTGGGCAATTAGCAACTTAACGATAAGTGGCAGAAAAGATCAA GTTGAATAC

CTTGTACAGCAGAACGTAATACCACCATTCTGTAACTTACTGTCAGTAAAAGATTCTCAAGTGGTGCAGGTGGTTCTAGATGGTCTTAAAAACATCCTGA

TAATGGCTGGTGATGAAGCAAGCACAATAGCTGAGATCATAGAAGAGTGTGGAG - UNI5468 - GTTTGGAGAAAATTGAAGTTTTGCAGCAACATG

AAAATGAAGACATATATAAATTAGCATTTGAAATCATAGATCAATATTTCTCTGGTGATGAT ATTGATGAAGATCCTAGCCTCATTCCAGAAGCAACAC

AAGGAGGTACTTACAATTTTGACCCAACAGCCAACCTTCAAACAAAAGAATTTAATTTCTAAGGTCAATTAAGTGCAGCATCTTTCATTCAATATGAAAC

ACCACCAGATGGCCACCAAGCGATAAGACAGCAAGCAACAGAAGGCTCCCAGCACTCTTGCCTCTTCATTTTGATGCTTCTAAAGCAAGCCATGTCTCAG

TCACTTTGCAGTTGCCAAAAGTCACTCTCACATGGACTGTAAATGCATATGCATGATTTCCTAAACTGTTTTAGAATTCTCCTTAACCATCTCAACTCCC

CTATATTTTCCATGTTCCCTGGTGCCACATGCTGACAACTGCAGTCTCCAGTTAGAATATTCCATAGTGGTGGTATATCAGCTGCCCACTGATACGCCTT

TGGAAAAAGGTGCGCTGTGGATCAAGACACTTTGGTATGATGTATATTCATGTTGGAAGACTACAGAGGTGCAGTGTGATCTGAGCCTCCATCATTGTCC

TCCACAAACATATTTTCATATTCTTATGTGGAAGAATTAAAAGTACAAGCCAAATGATTTTCATTGGTGAAACTGACACAAAAGTAACTTAAAAACAAGA

AACTTGGTTGTTGATTAAAAAGATAAGTTTTTTAAAACTGTACTTCACCTACCATTAATTGATGTGTTTATTATCTGCCTCAGAAGCCAGGGTTGGAGGA

AGAGCTTTAGATATCAATGGTAATGCTTTCGCCATTATACCTAATTTTTTGAGAACAGCAAATCCTATTTGACCACTCACTTCAGCCTGTGTGTTCCTGC

TGTTTTGAATAATCAAATGCTGTGCATGGTCTCTACCTGAGCTGCAACCTGTTACAGACTTGAACTTCTGTTAAGTTGAAAGCAAGAGTCCTTGACTACA

AAAATACACAAATAAATAAGTCAAAACAAGAATGGAAAAGGTTTAAATACTGATTGGTAAGGTTTTAAGACAAAGTCTTGCTTTCAGCTTCCAGGGGTTA

ATTTTATTTTTGTTTTAATTTGATAATTGGATATGGTTGATTTATATTGGGTTTAAACTGTGGAGCTTTCATGTTTACTGTAATTTAGTCTTAAAATATT

TTTTACTTAGTAACCAGTACTTTTGATAATGTGGTGGCAACAAACCAGCAACTATCTAGAAGTGTTACAAGACTTCATTCTTGAGTATTGGAGTTCATTC

AGATCTCACTCAAAGCATCTGCACACATTAAAAGATAAACCAAGGATCTGTGTAGAGGAATGGTCTGCAGTTATTTAACTCAGCCTGATTTGCAGTGATC

TTAAGCTCTGCAAAATCTGGCCTTACTATGTAAAGTCATTGCTTATGGCAAATGGTCTGACCCAGTTATTAATGAATGAATAGGGATTTGAAATTTTTTA

AACTAAATAATTTGTGCTGTCACAGAAATGGTTTTGTTGCTCTTGTTCACTGGGTATAATTTCCCAATGCATTGATGTGAAGGGATAGAAATCTAAACTA

AGATAGTTTTCAGATGGGGGGTGTATTTACTGTGATGAAGAAGAGACAGATGCCATCAGAGCTTTGTGAAACAGCTGGGGTGTTTTCACTGATAAACAAC

ACATAGCAGGTGTGCTTCATTACAAATATATGTATCTGCCAAGGTGGAGCCACTTTAAAGAGTGAGTTTTGTCTTGTATCTAAAATGGATACAAGCGTAT

GTTTAAACTGCAAGATTTTTACTTGCTAGAGAATCTGTTTTAATATAGTGGTTTGGCCTCTGATTATTTATAGGTTTTATAAATTTTAGAATCAATTTCT

CTTTAAGGTGGCTCAGATTTTTCAACTCTTGTGCACATAAAATTGAGTTGAAGTTCATTGTGCCTTTTTTCTTTACCCAAATTTTGAGTTAAAGCTTCAT

ATGGTAACTGCATCCTGTTCAAACACTTGTCTAAATTTTGAAACTGTGTAGTGTTCACTAAAAGTAGGAGTAACAAAGTCAGAATGAATTAAGGTCACAC

ACTCTGGTGAAACCCTTAAAGTCACAACCTTCTTGATAGTGTGAATTGTCCCCTTCCAGTTACTTCCTTCTGGTCTCTCCCTACTTAACTGACAGTTACC

TTTTAAATTTTGCACACATTGAGATTAAAATTGGGCTTCTACTGTGATGATTCCTATTTCCTCTCGCGTCTTAAGTGCAAACTAACCGTTAAGTAACGTT

GGCATCAAGTAGTGCAGACTCCGTGCCTCTGCTTGAGCGGTTTGCCGTGACCTGACCAGTTTTGAGTTGGAATCACACCATTTCGTAGATAAGGAAACTG

AGTGTATTGCTGCACTTTTAAGTTTTCAAAACAGTGTTTTAAAATTGCATTGTTTTTTTTTTTTAAACTCAGTTTAAAAAAAGACTAAAATGTTCTTTCA

AAAGAGGCATCTAAACGTGTTCCTAATTTTGTATATGGGCTTAGGTTTTGTAACCAATAAAAAAGCTGCTATCAAATATGATAAAACATTGAAAGACTTA

TTTCTGG
Translation
MAENPGLENHRIKSFKNKGRDVE - UNI7055 - TMRRHRNEVTVELRK - UNI2914 - NKRDEHLLKKRNVPQEESLEDSDVDADFKA - UNI

23312 - QNVTLEAILQ NATSDNPVVQLSAVQAAR RKLLSSDRNPPIDDLIKSGILPILVKCLERDDN - UNI4048 - NPSLQFEAAWALTNIA

SGTSAQTQAVVQSN NAVPLFLRLLHSPHQNVCEQAVWALGNIIG - UNI4046 - GDGPQCRDYVISLGVVKPLLSFINPSIPITFLRNVTWVIVNL

CRNKDPPPPMETVQE - UNI4051 - ILPALCVLIYHTDIN ILVDTVWALSYLTDGGNEQIQMVIDSGVVPFLVPLLSHQEVKVQ TAALRAVGNIV

TGTDEQTQVVLNCDVLSHFPNLLSHPKEKINK - UNI2155 - EAVWFLSNITAGNQQQVQAVIDAGLIPMIIHQLAK GDFGTQKEAAWAISNLTIS

GRKDQ VEYLVQQNVIPPFCNLLSVKDSQVVQVVLDGLKNILIMAGDEASTIAEIIEECGG - UNI5468 - GLEKIEVLQQHENEDIYKLAFEIIDQ

YFSGDD IDEDPSLIPEATQGGTYNFDPTANLQTKEFNF

For any suggestions or comments, please send an email to unitrap@crg.es