Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000021932 (Rnaseh2b)
Chromosomal location
Chr 14: 62950941 - 62991337 (+)
Description
ribonuclease H2, subunit B Gene [Source:MGI (curated);Acc:Rnaseh2b-001]
RefSeq_dna
NM_026001 
RefSeq_peptide
NP_080277.1 
MGI
MGI:1914403 
Uniprot/SWISSPROT
Q80ZV0 
Human Ortholog
ENSG00000136104 (RNASEH2B)
Omim 610181 - AICARDI-GOUTIERES SYNDROME 2  
UniTrap UNI10404
Vector Insertion
Chr 14: 62951014 - 62965404
Public Clones D072E11 (ggtc) E089E06 (ggtc) D107D03 (ggtc) E130A03 (ggtc) D068H12 (ggtc)
E047B02 (ggtc) D110A06 (ggtc) CMHD-GT_374F12-3 (cmhd) IST11696G3 (tigm)
IST11742F8 (tigm) IST14722H6 (tigm)
Private Clones OST374317 (lexicon) OST371447 (lexicon) OST371402 (lexicon) OST370134 (lexicon)
OST357545 (lexicon) OST357497 (lexicon) OST338619 (lexicon) OST311909 (lexicon)
OST67611 (lexicon) OST60649 (lexicon) OST44555 (lexicon) OST42763 (lexicon)
OST41008 (lexicon) OST35582 (lexicon) OST32972 (lexicon) OST32559 (lexicon)
Severity of mutation (?) Insertion after 7% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI21992
Vector Insertion
Chr 14: 62967466 - 62969236
Public Clones not available
Private Clones OST311928 (lexicon) OST59976 (lexicon) OST42230 (lexicon)
Severity of mutation (?) Insertion after 27% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI18068
Vector Insertion
Chr 14: 62969314 - 62972359
Public Clones not available
Private Clones OST430979 (lexicon) OST181447 (lexicon)
Severity of mutation (?) Insertion after 35% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI33352
Vector Insertion
Chr 14: 62972475 - 62979299
Public Clones IST10780C7 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 47% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI27979
Vector Insertion
Chr 14: 62984139 - 62989308
Public Clones not available
Private Clones OST43062 (lexicon)
Severity of mutation (?) Insertion after 80% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000022499
Sequence
CAGGGCGCGACCATGGCCGGAGGTCGGGACCGCGGGGACTTGGCGGCCAGGCAGCTAGTGTTCCTACTTCCAG - UNI10404 - AACATTTAAAAGA

TGCCTCGAAGAAGAAGAAGAAGAGCAGCCTCCTGTTCGTAAAGCTGGCCAACCCGCACTCAG GGGAAGGAGCCACATACTTAATTGATATGTGTCTTCA

ACAGCTGTTTGAAATAAAAGTTTTCAAGGAAAAACACCATTCTTGGTTTATAAATCAATCAGTTCAATCAG - UNI21992 - GGGGCCTTCTCCACT

TTGCCACACCCATGGATCCATTGTTCCTGCTCCTTCACTATCTCCTAAAGGCTGGCAAAGAG - UNI18068 - GGGAAGTATCAGCCCTTGGACCAA

GTCGTGGTCGATGACACGTTTCCAGATTGCACCTTGCTGCTGAGATTTCCTGAGCTTGAAAAGTCACTTCGGCATGTGACAGAGGAAAAAG - UNI333

52 - AAGTGAACAGCAAGAAGTACTATAAGTACAGCTCAGAGAAGACATTGAAGTGGCTGGAGAAGAAG GTCAACCAAACTGTGGTGGCACTAAAAGC

TAATAATGTCAATGTTGGAGCCCGGGTTCAGTCATCTGCATATTTCTCTGGTGGTCAGGTTTCCAGGGACAAGGAAG AGGATTATGTTCGCTATGCCCA

TGGTCTGATCTCTGATTACATCCCTAAAGAACTGAGTGATGATTTATCCAAGTTCTTGAA GCTTCCAGAACCTCCAGCTTCATTGACCAACCCTCCATC

AAAG - UNI27979 - AAACTAAAGTTATCAGATGAGCCTGTAGAAGCCAAAGAAGATTACACTAAGTTTAACACTAAAGACTTGAAGACCGGCAAG 

AAAAATAGCAAAATGACTGCAGCTCAGAAGGCTTTGGCTAAAGTTGACAAAAGTGGAATGAAAAGTATCGATGCCTTTTTTGGTGCAAAAAATAAAAAAA

CTGGAAAGATTTGAAGCATCGAAAATAAAATCCAGTGAAGC
Translation
MAGGRDRGDLAARQLVFLLPE - UNI10404 - EHLKDASKKKKKSSLLFVKLANPHSG GEGATYLIDMCLQQLFEIKVFKEKHHSWFINQSVQSG 

- UNI21992 - GGLLHFATPMDPLFLLLHYLLKAGKE - UNI18068 - GKYQPLDQVVVDDTFPDCTLLLRFPELEKSLRHVTEEKE - UNI33

352 - EVNSKKYYKYSSEKTLKWLEKK VNQTVVALKANNVNVGARVQSSAYFSGGQVSRDKEE EDYVRYAHGLISDYIPKELSDDLSKFLK KLPEP

PASLTNPPSK - UNI27979 - KLKLSDEPVEAKEDYTKFNTKDLKTGK KNSKMTAAQKALAKVDKSGMKSIDAFFGAKNKKTGKI

For any suggestions or comments, please send an email to unitrap@crg.es