Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000021936 (Mapk8)
Chromosomal location
Chr 14: 34191084 - 34260344 (-)
Description
mitogen-activated protein kinase 8 Gene [Source:MGI (curated);Acc:Mapk8-001]
RefSeq_dna
NM_016700 
RefSeq_peptide
NP_057909.1 
UniGene
Mm.404866 Mm.409682 Mm.412411 Mm.441782 
MGI
MGI:1346861 
Uniprot/SWISSPROT
Q91Y86 
Uniprot/SPTREMBL
A3KBF5 A6P3E4 Q544A0 Q7TSJ7 
Human Ortholog
ENSG00000107643 (MAPK8)
Omim not available
UniTrap UNI25238
Vector Insertion
Chr 14: 34224041 - 34224164
Public Clones not available
Private Clones OST190754 (lexicon) OST183210 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI31220
Vector Insertion
Chr 14: 34224041 - 34260315
Public Clones IST10084H4 (tigm) IST14683A6 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI9152
Vector Insertion
Chr 14: 34221364 - 34224041
Public Clones RRE012 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 13% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000111942
Sequence
ATGAGCAGAAGCAAACGTGACAACAATTTTTATAGTGTAGAGATTGGAGATTCTACATTCACAGTCCTAAAACGATACCAGAATTTAAAGCCTATAGGCT

CAGGAGCTCAAGGAATAGTGTG - UNI9152 - - UNI25238 - - UNI31220 - TGCAGCTTATGATGCCATTCTTGAAAGAAATGTTGCAAT

CAAGAAGCTCAGCCGGCCATTTCAGAATCAGACCCATGCTAAGCGCGCCTACCGAGAACTAGTTCTTATGAAGTGTGTTAATCACAAAAAT ATAATTGG

CCTTTTGAATGTTTTCACACCACAGAAATCCCTAGAAGAATTTCAAGATGT TTACATAGTCATGGAGCTCATGGATGCAAATCTTTGCCAAGTGATTCA

GATGGAGTTAGATCATGAAAGAATGTCCTACCTTCTCTATCAAATGCTGTGTGGAATCAAGCACCTTCACTCTGCTGGAATTATTCATCGG GACTTAAA

GCCTAGTAATATAGTAGTCAAATCAGACTGCACTTTGAAGATTCTTGATTTTGGACTGGCGAGGACTGCAGGAACGAGTTTTATGATGACGCCTTATGTG

GTGACTCGCTACTACAGAGCACCAGAGGTCATTCTCGGCATGGGCTACAAGGAGAACG CTGACTCAGAGCATAACAAACTTAAAG CCAGTCAGGCAAG

AGATTTGTTATCCAAAATGCTAGTAATAGATGCATCCAAAAGGATCTCCGTAGATGAAGCTCTCCAGCACCCATACATCAACGTCTGGTATGATCCTTCA

GAAGCAGAAGCC CCACCACCAAAGATCCCGGACAAGCAGTTAGATGAGAGGGAGCACACAATAGAGGAGTGGAAAG AACTGATATACAAGGAGGTAAT

GGATTTGGAGGAACGAACTAAGAATGGAGTCATAAGAGGGCAGCCGTCTCCTTTAG CACAGGTGCAGCAATGA
Translation
MSRSKRDNNFYSVEIGDSTFTVLKRYQNLKPIGSGAQGIVC - UNI9152 - - UNI25238 - - UNI31220 - CAAYDAILERNVAIKKLSRP

FQNQTHAKRAYRELVLMKCVNHKN IIGLLNVFTPQKSLEEFQDV VYIVMELMDANLCQVIQMELDHERMSYLLYQMLCGIKHLHSAGIIHR DLKPSN

IVVKSDCTLKILDFGLARTAGTSFMMTPYVVTRYYRAPEVILGMGYKENA ADSEHNKLKA ASQARDLLSKMLVIDASKRISVDEALQHPYINVWYDPS

EAEA PPPKIPDKQLDEREHTIEEWKE ELIYKEVMDLEERTKNGVIRGQPSPLA AQVQQ
Transcript ENSMUST00000111943
Sequence
ACTAATTGCTTGCCATCATGAGCAGAAGCAAACGTGACAACAATTTTTATAGTGTAGAGATTGGAGATTCTACATTCACAGTCCTAAAACGATACCAGAA

TTTAAAGCCTATAGGCTCAGGAGCTCAAGGAATAGTGTG - UNI9152 - - UNI25238 - - UNI31220 - TGCAGCTTATGATGCCATTCTT

GAAAGAAATGTTGCAATCAAGAAGCTCAGCCGGCCATTTCAGAATCAGACCCATGCTAAGCGCGCCTACCGAGAACTAGTTCTTATGAAGTGTGTTAATC

ACAAAAAT ATAATTGGCCTTTTGAATGTTTTCACACCACAGAAATCCCTAGAAGAATTTCAAGATGT TTACATAGTCATGGAGCTCATGGATGCAAAT

CTTTGCCAAGTGATTCAGATGGAGTTAGATCATGAAAGAATGTCCTACCTTCTCTATCAAATGCTGTGTGGAATCAAGCACCTTCACTCTGCTGGAATTA

TTCATCGG GACTTAAAGCCTAGTAATATAGTAGTCAAATCAGACTGCACTTTGAAGATTCTTGATTTTGGACTGGCGAGGACTGCAGGAACGAGTTTTA

TGATGACGCCTTATGTGGTGACTCGCTACTACAGAGCACCAGAGGTCATTCTCGGCATGGGCTACAAGGAGAACG TTGACATTTGGTCAGTTGGGTGCA

TCATGGGAGAAATGATCAAAGGTGGTGTTTTGTTCCCAGGTACAGATC ATATTGATCAGTGGAATAAAGTTATTGAACAGCTCGGAACACCTTGTCCTG

AATTCATGAAGAAACTACAACCAACAGTAAGGACTTATGTTGAAAACAGGCCTAAATACGCTGGATATAGCTTTGAGAAACTGTTCCCCGATGTGCTTTT

CCCAGCTGACTCAGAGCATAACAAACTTAAAG CCAGTCAGGCAAGAGATTTGTTATCCAAAATGCTAGTAATAGATGCATCCAAAAGGATCTCCGTAGA

TGAAGCTCTCCAGCACCCATACATCAACGTCTGGTATGATCCTTCAGAAGCAGAAGCC CCACCACCAAAGATCCCGGACAAGCAGTTAGATGAGAGGGA

GCACACAATAGAGGAGTGGAAAG AACTGATATACAAGGAGGTAATGGATTTGGAGGAACGAACTAAGAATGGAGTCATAAGAGGGCAGCCGTCTCCTTT

AG CACAGGTGCAGCAATGATCAATGGCTCTCAGCATCCATCGTCTTCGCCGTCTGTCAATGACATGTCTTCAATGTCCACAGATCCGACTTTGGCCTCG

GATACAGACAGCAGTCTAGAAGCATCAGCTGGACCTCTGGGCTGCTGTAGATGACTAC
Translation
MSRSKRDNNFYSVEIGDSTFTVLKRYQNLKPIGSGAQGIVC - UNI9152 - - UNI25238 - - UNI31220 - CAAYDAILERNVAIKKLSRP

FQNQTHAKRAYRELVLMKCVNHKN IIGLLNVFTPQKSLEEFQDV VYIVMELMDANLCQVIQMELDHERMSYLLYQMLCGIKHLHSAGIIHR DLKPSN

IVVKSDCTLKILDFGLARTAGTSFMMTPYVVTRYYRAPEVILGMGYKENV VDIWSVGCIMGEMIKGGVLFPGTDH HIDQWNKVIEQLGTPCPEFMKKL

QPTVRTYVENRPKYAGYSFEKLFPDVLFPADSEHNKLKA ASQARDLLSKMLVIDASKRISVDEALQHPYINVWYDPSEAEA PPPKIPDKQLDEREHTI

EEWKE ELIYKEVMDLEERTKNGVIRGQPSPLA AQVQQ
Transcript ENSMUST00000111945
Sequence
TCTGTTAGTCAGCGGAGCGGCCGAGGCCGGACGTTGCGGCCGAAACGCGGAGCCGCGAACAGGATTGAGTAGCGGCCGCGGCCACCGCAGGACGGCGCCG

TTCTCCGCTACGGGCTTCCAGGTCGCCGTTGGCTGCACTGCCGG - UNI31220 - CCTTGGTGAATATTTGGATGAAGCCATTAGACTAATTGCTTG

CCATCATGAGCAGAAGCAAACGTGACAACAATTTTTATAGTGTAGAGATTGGAGATTCTACATTCACAGTCCTAAAACGATACCAGAATTTAAAGCCTAT

AGGCTCAGGAGCTCAAGGAATAGTGTG - UNI9152 - - UNI25238 - - UNI31220 - TGCAGCTTATGATGCCATTCTTGAAAGAAATGTT

GCAATCAAGAAGCTCAGCCGGCCATTTCAGAATCAGACCCATGCTAAGCGCGCCTACCGAGAACTAGTTCTTATGAAGTGTGTTAATCACAAAAAT ATA

ATTGGCCTTTTGAATGTTTTCACACCACAGAAATCCCTAGAAGAATTTCAAGATGT TTACATAGTCATGGAGCTCATGGATGCAAATCTTTGCCAAGTG

ATTCAGATGGAGTTAGATCATGAAAGAATGTCCTACCTTCTCTATCAAATGCTGTGTGGAATCAAGCACCTTCACTCTGCTGGAATTATTCATCGG GAC

TTAAAGCCTAGTAATATAGTAGTCAAATCAGACTGCACTTTGAAGATTCTTGATTTTGGACTGGCGAGGACTGCAGGAACGAGTTTTATGATGACGCCTT

ATGTGGTGACTCGCTACTACAGAGCACCAGAGGTCATTCTCGGCATGGGCTACAAGGAGAACG TGGACTTATGGTCTGTGGGGTGCATTATGGGAGAAA

TGGTTTGCCACAAAATCCTCTTTCCAGGAAGGGACT ATATTGATCAGTGGAATAAAGTTATTGAACAGCTCGGAACACCTTGTCCTGAATTCATGAAGA

AACTACAACCAACAGTAAGGACTTATGTTGAAAACAGGCCTAAATACGCTGGATATAGCTTTGAGAAACTGTTCCCCGATGTGCTTTTCCCAGCTGACTC

AGAGCATAACAAACTTAAAG CCAGTCAGGCAAGAGATTTGTTATCCAAAATGCTAGTAATAGATGCATCCAAAAGGATCTCCGTAGATGAAGCTCTCCA

GCACCCATACATCAACGTCTGGTATGATCCTTCAGAAGCAGAAGCC CCACCACCAAAGATCCCGGACAAGCAGTTAGATGAGAGGGAGCACACAATAGA

GGAGTGGAAAG AACTGATATACAAGGAGGTAATGGATTTGGAGGAACGAACTAAGAATGGAGTCATAAGAGGGCAGCCGTCTCCTTTAG CACAGGTGC

AGCAATGATCAATGGCTCTCAGCATCCATCGTCTTCGCCGTCTGTCAATGACATGTCTTCAATGTCCACAGATCCGACTTTGGCCTCGGATACAGACAGC

AGTCTAGAAGCATCAGCTGGACCTCTGGGCTGCTGTAGATGACTACTTGGGCCTTGGGTGGGTGGGAGGGATGGGGAATTGGTTAGTCATTGATAGAACT

GCTTTAAAAACAATTCAGTGGTCATATTTTTGAGTGATTTTTCAGAAAATGTAGAATTCATTTTGTAGTAAAGTAGTTTATTTTTTTTAATTTCAAGTGT

TGTAATTTAAAACTTAAGTTGTGTTTTTAAACAGCAACAAAACTGTATTGTATTTTTGCTGTAATTAACTGTATAATGTAAACCTAATTATTTTATCATG

GTTTAAATTTTGCATATTTGCTTTATCTTATGCTGCTGATTTTTTTACTGAATTTGTAAAATTTTTGTTTATCAAAGCAACTATTATGTGGTGACTTGCA

TATATCATGAATTATTTAAGATGTTTATAAGTTTTTTATTAGAATTTATTTCAGATGTTTGTTCATGATGCTATCCTTCAGGGTTATGTGCTTATCAATG

AAATAACCCCAGAGGAATAAGGGAAAATAACCTGTAGCCAGTTATATTCAGGAATAACTACTGTAAATGATGAACGCATCAAGAAACCTCCAATATTTGC

TACTTGCCAATCCCAACTTAGTTAAAACAATTGGTAGGCAACCTTACCTAAATTTTAGCAAACACCTTATCTAATGGCAGAATAACTCAGAGCATGTCTT

TAAAGATGCTGGGCACATCCTTCTCCATTTTGAATCTCCTACACCAACCCAAGAAAAACTTAAACTAAGGAATGTGGTATATTCTGATCATCTGTGGCAT

GCTTAAAGCTTTTGATCACACAAAGTTAAGAGGACACTTCATGAATCTACATTTCCGTGGAGATCAACAGATGCTTCCCCTGTCCTGGCTACGAGCCTGC

TTCTGTAGACACTGAGTTAATCTCCTCAGGCTGTAGGTCCTGGCATTGGCCACGAGCCTGGACTTTCCCTGTTGGACAGCTTCTGGCCTCTGGCCTTTCC

CAGTTCCTGTTCCTTAGCGGGTCAGTCTGTTGAGCACCAGTTTGTGGTGTTTCTGGCCATTTGATTCTACCTGTAGCATTATCCTGTTTCTACTAGCTGT

CAGGAGGTTCCAAAGCCTACTTAAACTTGTGTAGGTGACATTTAAATGAGCAATATGCCGTTCATCTGAAAATAGTAGCACACAGCCATATGTAGGATGT

CATTTTCTAAGGACTGTTTCTTCACAGTGAGCAGAGCAGGCATAGTGGTGGTTCTTTCATCTGAGTCTTTGGTTTTTTATATCTGATTTCCAGTATGGAC

GTTGAGTAGTGTAAGAATGGTGCTGCTCCTGACAAGTGTGTGTTAACTGTTTACATTTTATATCTGCAGAATCCTTTCTCTGTAACTGAATTTTCCTAAG

TAAAATGTCATCAAGGTCTCATTATTTCTGAAATGATGTCTATAATGCCCAGGCACCTTTGGTATTATCTGGAACAAGAGGGATTTCATGTAATGAACTG

GGAAATGCATACTTCATGAGCTGCAAGGTTGTAGGAAGGAGCCCGGAGCCCCTTGGAGCTCACAATCAGCAGGAGTAAGAGCGGGCACAGCTTGGCAGAT

TTCTGAAAGGTTGCTTAGCAGGTTCTTTTGTTTTGGTTTTTGGATTTTTCTTCTTTTGGTTGCTTTTTAAAAACATTTAGTGTACAATTACTTTCAAGTA

AGCTATTTTAAGTCTTGTTAATGTGCAATACTTAAGATTAAGATATTACCTTTTTAAACATAGCAAGTTTATCAAGATTTCTAGCGTCCCATCTTTTAGT

GATTCCTTTTCTATATGTACAACATGGTGCATTTATTTTATTAGACAAGTATGAATTTGAGACTGTTACGCCTCTTGGTTCTAGAAATACAAGGTTGAAG

TCAGGATTTTAGCAGAAATTGGAGCATGAGTGTGTTCTTATTTTATATTAGTTTTGCATCTAACTGGTTTTGGTTTTGCCGTGATAAAATGTGTCACTAT

TGCACTTACCAGCTGATATGCTGTAGTTAGTTTTCTGTGTTTGTGTTTGATTGCTGAGAAGCCATCTTCTTCATTCAGATTTCGGGTAAGTAAGGAATAC

TAGTTGTTTGATTGTCTCATCTGTTGTAATTGCCAGCTCCCACTTGCCAGCAATCATGTTTCAGTTAAATTTAAAAAAAAAAAAAACAACAAGCTCTCAA

TGCTTAATGTAAGCTGAAATACCTAACAGAGTATACCTAAAAGCAAGGTCTGTTTGTTAAACATGTGCCCAACACATTAAGATCCACTGTACACACACAC

ACACACACACAAAACACACCACTGTGTTTAAATCTTTTAACATAAATCCTACTGGTACTTTTAGAGTCTTAAAGCATCTTAAGTATTTTTTTAAGAAATT

ACAAATAACATTTCTGTCTATCAGTACTTATTAAGCCACCCTATAATTTGACTTTTCAATTATATATACTTATGATACCCATTGTCTTACTGTCTAAAAG

TTGTTTAGCTGAGAATTAGCATTCCACTTCATGGTTTAGGAAAGAGAGCCTTATTCTTCCTACATGTCTTCCTGGTTACAGGTCTCGTACCCACTAATAC

ATAGTGACCATCTGTAAGATGAGCATGTTGTTGGGATTGCTTTGTTATAGAGCATCTCACTCTTTAATGCTATTTGCTAGTGGTTTTTACTGTGTCATGC

CATGCTGCTGATTGCCAAATCTCAGAAGAGTGCACACCAGAAGCAAAGGCCCAGTGTGTTCACACCTGGCTAGTAAGAGAAGCAGTAGTCCCCACCAATA

CAGAGAAGCTGGTTGTGTACAAAGCTTGCCTGTCAGCCTTATCCCTCAGTTCTGAGCTCATCTCACTTTGTTACCCTAAGACGTGGAGGTAGAAAAGACA

CTTGACAGGATAGGATGAGCAGTAGGCAAGGGAAGCTGTTTCCTGAGTTACAAAAAGAACTTGGTTTACATTATTGGCCAGTTTCTGCCGCACACATGAA

GACATCATCAGTGTTGCCTCAGCGCTAGCCTGCACGGCATTTTGAGATTGAAAAAAAAAACCAACAACATAGTATATTTTCAGAAATACTGTTGTAGTTT

GTGAGTGTTGTTCATTAGTCACTCATTAGTGTAGAGTGGATGCATGATGCCCCATGACCCCAGTAAGTCTTACCAGTGAGTAGAATACCCAGCACCGTCT

CTCACCCGTAGCCCTCTTCAGCATTGCCTCGTGGCTTGTTGCATTCTAGTGTGCATATTCTAGTGTGCATTGTGTTTCTACTGATCTCTTGGGTGTTTCC

TGTGAACCACAGGAGGCACATTTGTCCTAATCGCACGAAAGAAAGATGAAAGAGATAAGGGCATTGAAGCAGAAATGTGTGGTTTGGGGTAAGATAGGAA

AATTGTGTCCTAATTAATTTCAAAGTAACTGCTCTTAGGCAAATTGCTTTTAAGGGGAGTCTAGTAAGCAACTTTCTGGGCACTTCTGGTTTAGATTCTC

TTCATTACTGAAACTCCTGAGAAATATTACCTGTGGATTAGTTTTGCACAATGTCCTATTCTCACAATGACTTAAAATTAAACTAGGTTTTTATTGAACT

ACCTCACACTGATTTTCTATGCTTTCCCAAGTAAGCTGTAGCCCTTACTGTTTGACCTTTACTGAGTGTAAATTATAAATGTGCGTTGAATACTTTCTAG

CCACTGTTCACAAAATACCAGTAAGCATGTGAAGTGCAAACCTTGCGTCAGTAAGAGACAGTCCCGTGTAGTCTTCCACTGTGTCTGGGGAATTGTGCTG

CATACGCTTATTGACATCCTCACTGTTTTTGTAAGAAACCTGCTCGAGATACCAGTCCATGCTTTACATTTTACAGAAGGAGAAAATCTTAGTAAATTTT

ACGAAGAAATACATTACTTTTGTAGGCCCAATATTTGGTATATTTTTGAGAAGCTGTTAATCTTATAGCGGAATGATGAAGTTACACTGAAGTAGCTGTC

TGCCTGGACTGTGATGTCTGTTTTCTCATTACGGTTTACCCTGTTAATAAGGTTTTAAACCTCAAAACATAGGATGATAATTAGATTTTTTCCTCTTTCC

CTGTACATGTCATTCCTTCATCCCGCCCCTTCCGTGTGCTCTCCTCTCTTCTCCTCTAGACAAAACAAATGGGCACTTTGTAGGGAATGCTGGGATCGTT

ACCGTGGGTTATCGTTCATGCCCTAGTCATTCAACATGCACCACTGGGTGTAAACAGTGTTATCTAGTGTGTCAATTGGTTATAATATTTTAAATAAAAA

AGAAAAAGTGGTATGAAA
Translation
 - UNI31220 - MSRSKRDNNFYSVEIGDSTFTVLKRYQNLKPIGSGAQGIVC - UNI9152 - - UNI25238 - - UNI31220 - CAAYDA

ILERNVAIKKLSRPFQNQTHAKRAYRELVLMKCVNHKN IIGLLNVFTPQKSLEEFQDV VYIVMELMDANLCQVIQMELDHERMSYLLYQMLCGIKHLH

SAGIIHR DLKPSNIVVKSDCTLKILDFGLARTAGTSFMMTPYVVTRYYRAPEVILGMGYKENV VDLWSVGCIMGEMVCHKILFPGRDY YIDQWNKVI

EQLGTPCPEFMKKLQPTVRTYVENRPKYAGYSFEKLFPDVLFPADSEHNKLKA ASQARDLLSKMLVIDASKRISVDEALQHPYINVWYDPSEAEA PPP

KIPDKQLDEREHTIEEWKE ELIYKEVMDLEERTKNGVIRGQPSPLA AQVQQ
Transcript ENSMUST00000022504
Sequence
GGAGCGGCCGAGGCCGGACGTTGCGGCCGAAACGCGGAGCCGCGAACAGGATTGAGTAGCGGCCGCGGCCACCGCAGGACGGCGCCGTTCTCCGCTACGG

GCTTCCAGGTCGCCGTTGGCTGCACTGCCGG - UNI31220 - CCTTGGTGAATATTTGGATGAAGCCATTAGACTAATTGCTTGCCATCATGAGCAG

AAGCAAACGTGACAACAATTTTTATAGTGTAGAGATTGGAGATTCTACATTCACAGTCCTAAAACGATACCAGAATTTAAAGCCTATAGGCTCAGGAGCT

CAAGGAATAGTGTG - UNI9152 - - UNI25238 - - UNI31220 - TGCAGCTTATGATGCCATTCTTGAAAGAAATGTTGCAATCAAGAAGC

TCAGCCGGCCATTTCAGAATCAGACCCATGCTAAGCGCGCCTACCGAGAACTAGTTCTTATGAAGTGTGTTAATCACAAAAAT ATAATTGGCCTTTTGA

ATGTTTTCACACCACAGAAATCCCTAGAAGAATTTCAAGATGT TTACATAGTCATGGAGCTCATGGATGCAAATCTTTGCCAAGTGATTCAGATGGAGT

TAGATCATGAAAGAATGTCCTACCTTCTCTATCAAATGCTGTGTGGAATCAAGCACCTTCACTCTGCTGGAATTATTCATCGG GACTTAAAGCCTAGTA

ATATAGTAGTCAAATCAGACTGCACTTTGAAGATTCTTGATTTTGGACTGGCGAGGACTGCAGGAACGAGTTTTATGATGACGCCTTATGTGGTGACTCG

CTACTACAGAGCACCAGAGGTCATTCTCGGCATGGGCTACAAGGAGAACG TTGACATTTGGTCAGTTGGGTGCATCATGGGAGAAATGATCAAAGGTGG

TGTTTTGTTCCCAGGTACAGATC ATATTGATCAGTGGAATAAAGTTATTGAACAGCTCGGAACACCTTGTCCTGAATTCATGAAGAAACTACAACCAAC

AGTAAGGACTTATGTTGAAAACAGGCCTAAATACGCTGGATATAGCTTTGAGAAACTGTTCCCCGATGTGCTTTTCCCAGCTGACTCAGAGCATAACAAA

CTTAAAG CCAGTCAGGCAAGAGATTTGTTATCCAAAATGCTAGTAATAGATGCATCCAAAAGGATCTCCGTAGATGAAGCTCTCCAGCACCCATACATC

AACGTCTGGTATGATCCTTCAGAAGCAGAAGCC CCACCACCAAAGATCCCGGACAAGCAGTTAGATGAGAGGGAGCACACAATAGAGGAGTGGAAAG A

ACTGATATACAAGGAGGTAATGGATTTGGAGGAACGAACTAAGAATGGAGTCATAAGAGGGCAGCCGTCTCCTTTAG GTGCAGCAATGATCAATGGCTC

TCAGCATCCATCGTCTTCGCCGTCTGTCAATGACATGTCTTCAATGTCCACAGATCCGACTTTGGCCTCGGATACAGACAGCAGTCTAGAAGCATCAGCT

GGACCTCTGGGCTGCTGTAGATGACTACTTGGGCCTTGGGTGGGTGGGAGGGATGGGGAATTGGTTAGTCATTGATAGAACTGCTTTAAAAACAATTCAG

TGGTCATATTTTTGAGTGATTTTTCAGAAAATGTAGAATTCATTTTGTAGTAAAGTAGTTTATTTTTTTTAATTTCAAGTGTTGTAATTTAAAACTTAAG

TTGTGTTTTTAAACAGCAACAAAACTGTATTGTATTTTTGCTGTAATTAACTGTATAATGTAAACCTAATTATTTTATCATGGTTTAAATTTTGCATATT

TGCTTTATCTTATGCTGCTGATTTTTTTACTGAATTTGTAAAATTTTTGTTTATCAAAGCAACTATTATGTGGTGACTTGCATATATCATGAATTATTTA

AGATGTTTATAAGTTTTTTATTAGAATTTATTTCAGATGTTTGTTCATGATGCTATCCTTCAGGGTTATGTGCTTATCAATGAAATAACCCCAGAGGAAT

AAGGGAAAATAACCTGTAGCCAGTTATATTCAGGAATAACTACTGTAAATGATGAACGCATCAAGAAACCTCCAATATTTGCTACTTGCCAATCCCAACT

TAGTTAAAACAATTGGTAGGCAACCTTACCTAAATTTTAGCAAACACCTTATCTAATGGCAGAATAACTCAGAGCATGTCTTTAAAGATGCTGGGCACAT

CCTTCTCCATTTTGAATCTCCTACACCAACCCAAGAAAAACTTAAACTAAGGAATGTGGTATATTCTGATCATCTGTGGCATGCTTAAAGCTTTTGATCA

CACAAAGTTAAGAGGACACTTCATGAATCTACATTTCCGTGGAGATCAACAGATGCTTCCCCTGTCCTGGCTACGAGCCTGCTTCTGTAGACACTGAGTT

AATCTCCTCAGGCTGTAGGTCCTGGCATTGGCCACGAGCCTGGACTTTCCCTGTTGGACAGCTTCTGGCCTCTGGCCTTTCCCAGTTCCTGTTCCTTAGC

GGGTCAGTCTGTTGAGCACCAGTTTGTGGTGTTTCTGGCCATTTGATTCTACCTGTAGCATTATCCTGTTTCTACTAGCTGTCAGGAGGTTCCAAAGCCT

ACTTAAACTTGTGTAGGTGACATTTAAATGAGCAATATGCCGTTCATCT
Translation
 - UNI31220 - MSRSKRDNNFYSVEIGDSTFTVLKRYQNLKPIGSGAQGIVC - UNI9152 - - UNI25238 - - UNI31220 - CAAYDA

ILERNVAIKKLSRPFQNQTHAKRAYRELVLMKCVNHKN IIGLLNVFTPQKSLEEFQDV VYIVMELMDANLCQVIQMELDHERMSYLLYQMLCGIKHLH

SAGIIHR DLKPSNIVVKSDCTLKILDFGLARTAGTSFMMTPYVVTRYYRAPEVILGMGYKENV VDIWSVGCIMGEMIKGGVLFPGTDH HIDQWNKVI

EQLGTPCPEFMKKLQPTVRTYVENRPKYAGYSFEKLFPDVLFPADSEHNKLKA ASQARDLLSKMLVIDASKRISVDEALQHPYINVWYDPSEAEA PPP

KIPDKQLDEREHTIEEWKE ELIYKEVMDLEERTKNGVIRGQPSPLG GAAMINGSQHPSSSPSVNDMSSMSTDPTLASDTDSSLEASAGPLGCCR
Transcript ENSMUST00000111944
Sequence
ACGTTGCGGCCGAAACGCGGAGCCGCGAACAGGATTGAGTAGCGGCCGCGGCCACCGCAGGACGGCGCCGTTCTCCGCTACGGGCTTCCAGGTCGCCGTT

GGCTGCACTGCCGG - UNI31220 - CCTTGGTGAATATTTGGATGAAGCCATTAGACTAATTGCTTGCCATCATGAGCAGAAGCAAACGTGACAACA

ATTTTTATAGTGTAGAGATTGGAGATTCTACATTCACAGTCCTAAAACGATACCAGAATTTAAAGCCTATAGGCTCAGGAGCTCAAGGAATAGTGTG - 

UNI9152 - - UNI25238 - - UNI31220 - TGCAGCTTATGATGCCATTCTTGAAAGAAATGTTGCAATCAAGAAGCTCAGCCGGCCATTTCAG

AATCAGACCCATGCTAAGCGCGCCTACCGAGAACTAGTTCTTATGAAGTGTGTTAATCACAAAAAT ATAATTGGCCTTTTGAATGTTTTCACACCACAG

AAATCCCTAGAAGAATTTCAAGATGT TTACATAGTCATGGAGCTCATGGATGCAAATCTTTGCCAAGTGATTCAGATGGAGTTAGATCATGAAAGAATG

TCCTACCTTCTCTATCAAATGCTGTGTGGAATCAAGCACCTTCACTCTGCTGGAATTATTCATCGG GACTTAAAGCCTAGTAATATAGTAGTCAAATCA

GACTGCACTTTGAAGATTCTTGATTTTGGACTGGCGAGGACTGCAGGAACGAGTTTTATGATGACGCCTTATGTGGTGACTCGCTACTACAGAGCACCAG

AGGTCATTCTCGGCATGGGCTACAAGGAGAACG TGGACTTATGGTCTGTGGGGTGCATTATGGGAGAAATGGTTTGCCACAAAATCCTCTTTCCAGGAA

GGGACT ATATTGATCAGTGGAATAAAGTTATTGAACAGCTCGGAACACCTTGTCCTGAATTCATGAAGAAACTACAACCAACAGTAAGGACTTATGTTG

AAAACAGGCCTAAATACGCTGGATATAGCTTTGAGAAACTGTTCCCCGATGTGCTTTTCCCAGCTGACTCAGAGCATAACAAACTTAAAG CCAGTCAGG

CAAGAGATTTGTTATCCAAAATGCTAGTAATAGATGCATCCAAAAGGATCTCCGTAGATGAAGCTCTCCAGCACCCATACATCAACGTCTGGTATGATCC

TTCAGAAGCAGAAGCC CCACCACCAAAGATCCCGGACAAGCAGTTAGATGAGAGGGAGCACACAATAGAGGAGTGGAAAG AACTGATATACAAGGAGG

TAATGGATTTGGAGGAACGAACTAAGAATGGAGTCATAAGAGGGCAGCCGTCTCCTTTAG GTGCAGCAATGATCAATGGCTCTCAGCATCCATCGTCTT

CGCCGTCTGTCAATGACATGTCTTCAATGTCCACAGATCCGACTTTGGCCTCGGATACAGACAGCAGTCTAGAAGCATCAGCTGGACCTCTGGGCTGCTG

TAGATGACTACTTGGGCCTTGGGTGGGTGGGAGGGATGGGGAATTGGTTAGTCATTGATAGAACTGCTTTAAAAACAATTCAGTGGTCATATTTTTGAGT

GATTTTTCAGAAAATGTAGAATTCATTTTGTAGTAAAGTAGTTTATTTTTTTTAATTTCAAGTGTTGTAATTTAAAACTTAAGTTGTGTTTTTAAACAGC

AACAAAACTGTATTGTATTTTTGCTGTAATTAACTGTATAATGTAAACCTAATTATTTTATCATGGTTTAAATTTTGCATATTTGCTTTATCTTATGCTG

CTGATTTTTTTACTGAATTTGTAAAATTTTTGTTTATCAAAGCAACTATTATGTGGTGACTTGCATATATCATGAATTATTTAAGATGTTTATAAGTTTT

TTATTAGAATTTATTTCAGATGTTTGTTCATGATGCTATCCTTCAGGGTTATGTGCTTATCAATGAAATAACCCCAGAGGAATAAGGGAAAATAACCTGT

AGCCAGTTATATTCAGGAATAACTACTGTAAATGATGAACGCATCAAGAAACCTCCAATATTTGCTACTTGCCAATCCCAACTTAGTTAAAACAATTGGT

AGGCAACCTTACCTAAATTTTAGCAAACACCTTATCTAATGGCAGAATAACTCAGAGCATGTCTTTAAAGATGCTGGGCACATCCTTCTCCATTTTGAAT

CTCCTACACCAACCCAAGAAAAACTTAAACTAAGGAATGTGGTATATTCTGATCATCTGTGGCATGCTTAAAGCTTTTGATCACACAAAGTTAAGAGGAC

ACTTCATGAATCTACATTTCCGTGGAGATCAACAGATGCTTCCCCTGTCCTGGCTACGAGCCTGCTTCTGTAGACACTGAGTTAATCTCCTCAGGCTGTA

GGTCCTGGCATTGGCCACGAGCCTGGACTTTCCCTGTTGGACAGCTTCTGGCCTCTGGCCTTTCCCAGTTCCTGTTCCTTAGCGGGTCAGTCTGTTGAGC

ACCAGTTTGTGGTGTTTCTGGCCATTTGATTCTACCTGTAGCATTATCCTGTTTCTACTAGCTGTCAGGAGGTTCCAAAGCCTACTTAAACTTGTGTAGG

TGACATTTAAATGAGCAATATGCCGTTCATCTGAAAATAGTAGCACACAGCCATATGTAGGATGTCATTTTCTAAGGACTGTTTCTTCACAGTGAGCAGA

GCAGGCATAGTGGTGGTTCTTTCATCTGAGTCTTTGGTTTTTTATATCTGATTTCCAGTATGGACGTTGAGTAGTGTAAGAATGGTGCTGCTCCTGACAA

GTGTGTGTTAACTGTTTACATTTTATATCTGCAGAATCCTTTCTCTGTAACTGAATTTTCCTAAGTAAAATGTCATCAAGGTCTC
Translation
 - UNI31220 - MSRSKRDNNFYSVEIGDSTFTVLKRYQNLKPIGSGAQGIVC - UNI9152 - - UNI25238 - - UNI31220 - CAAYDA

ILERNVAIKKLSRPFQNQTHAKRAYRELVLMKCVNHKN IIGLLNVFTPQKSLEEFQDV VYIVMELMDANLCQVIQMELDHERMSYLLYQMLCGIKHLH

SAGIIHR DLKPSNIVVKSDCTLKILDFGLARTAGTSFMMTPYVVTRYYRAPEVILGMGYKENV VDLWSVGCIMGEMVCHKILFPGRDY YIDQWNKVI

EQLGTPCPEFMKKLQPTVRTYVENRPKYAGYSFEKLFPDVLFPADSEHNKLKA ASQARDLLSKMLVIDASKRISVDEALQHPYINVWYDPSEAEA PPP

KIPDKQLDEREHTIEEWKE ELIYKEVMDLEERTKNGVIRGQPSPLG GAAMINGSQHPSSSPSVNDMSSMSTDPTLASDTDSSLEASAGPLGCCR

For any suggestions or comments, please send an email to unitrap@crg.es