Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000021947 (Cryl1)
Chromosomal location
Chr 14: 57893872 - 58017360 (-)
Description
crystallin, lambda 1 Gene [Source:MGI Symbol;Acc:MGI:1915881]
RefSeq_dna
NM_030004 
RefSeq_peptide
NP_084280.2 
UniGene
Mm.25539 
MGI
MGI:1915881 
Uniprot/SWISSPROT
Q99KP3 
Uniprot/SPTREMBL
Q9D221 A7VMV2 
Human Ortholog
ENSG00000165475 (CRYL1)
Omim not available
UniTrap UNI26575
Vector Insertion
Chr 14: 58001703 - 58017244
Public Clones not available
Private Clones OST109796 (lexicon)
Severity of mutation (?) Insertion after 10% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI17391
Vector Insertion
Chr 14: 57931967 - 57960888
Public Clones not available
Private Clones OST443585 (lexicon)
Severity of mutation (?) Insertion after 29% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000089502
Sequence
ATTCTGGCGCGCGACCCGCTCTGCTTTGCTCGCTCCCTCCGCTAACGCAGCTGTACAGCCAGGCCCGGATCTGCCATGGCGTCCCCAGCAGCGGGCGGGG

TGGTGATCGTAGGCAG - UNI26575 - TGGGCTCATTGGTCGGAGCTGGGCTATGCTGTTTGCCAGTGGAGGCTTCAAGGTGAAACTCTATGACATT

GAGCAACAGCAGATAACAGACGCCCTGGAAAATATCAG GAAGGAGATGAAATCCCTGGAGCAGTCTGGTTCTCTCAAAGGCTCCTTGAGCGCAGAGCGG

CAGCTGTCTCTCATCAGTGGCTGTGGCAACCTGGCCGAAGCAGTAGAGGGCGCTGTGCACATTCAG CAGATACGGTGGAGCAGGGTGAGCACCCTGGCT

GTGGACGTGGATTGTGATACCAGTGTTGTCTGTGACCGACGTCAGCTCTCTCCGAGTTCTGCTGTCACACACAAGTGTCTGGAAGCCTCATTAGCCTCTC

ACCTAGCACACTAG
Translation
MASPAAGGVVIVGS - UNI26575 - SGLIGRSWAMLFASGGFKVKLYDIEQQQITDALENIR RKEMKSLEQSGSLKGSLSAERQLSLISGCGNLAE

AVEGAVHIQ QIRWSRVSTLAVDVDCDTSVVCDRRQLSPSSAVTHKCLEASLASHLAH
Transcript ENSMUST00000022517
Sequence
ATTCTGGCGCGCGACCCGCTCTGCTTTGCTCGCTCCCTCCGCTAACGCAGCTGTACAGCCAGGCCCGGATCTGCCATGGCGTCCCCAGCAGCGGGCGGGG

TGGTGATCGTAGGCAG - UNI26575 - TGGGCTCATTGGTCGGAGCTGGGCTATGCTGTTTGCCAGTGGAGGCTTCAAGGTGAAACTCTATGACATT

GAGCAACAGCAGATAACAGACGCCCTGGAAAATATCAG GAAGGAGATGAAATCCCTGGAGCAGTCTGGTTCTCTCAAAGGCTCCTTGAGCGCAGAGCGG

CAGCTGTCTCTCATCAGTGGCTGTGGCAACCTGGCCGAAGCAGTAGAGGGCGCTGTGCACATTCAG - UNI17391 - GAGTGTGTTCCAGAGAACCT

AGAACTGAAAAAGAAGATCTTTGCCCAGCTGGACCGCATTGTGGATGACCGGGTTATCCTAAGCAGCTCCAGCTCTTGTCTGCTGCCTTCCAAGCTGTTC

TCGGGCTTGGCTCATGTGAAGCAGTGCATTGTGGCTCATCCT GTCAATCCACCATATTATGTCCCCCTGGTTGAGCTAGTGCCCCACCCAGAGACAGCT

CCAGCCACAATGGACAGAACCTATGCCTTGATGAAGAAGATTGGGCAGTCCCCAGTGAGAGTCCTGAAGGAGATTGACGGCTTCGTCCTGAACCGCCTGC

AGTACGCCGTCATCAGTGAGGCCTGGAGACTGGTGGAG GAAGAAATAGTATCTCCTAGCGACCTAGACCTGGTCATGTCAGACGGGCTGGGCATGCGGT

ACGCGTTCATCGGACCCTTGGAGACTATGCACCTCAATGCTGAAG GTGTGATTAGCTACTGTGAGAGATACAGTGAAGGGATGAAGCACGTCCTCAGTA

CTTTCGGGCCTGTTCCAGAGTTCTCAGGGGCCACGGTGGAGAGAGTTAGTGAG GACATGTGCATGAAGGTTCCTGATGATCCGGAGCACTTAGCTGCCA

GGAGGCAGTGGAGGGACGACTGCCTCATGAAGCTCTCCATACTGAAGTACCAGATGCAGCCCAAGTGAATTTCCTGTAATGCTGCTGCCCCTCCTTCCTG

GGCAGCTCTACTGGGGAGATGAGAAGCTCTTGATCCAATCCCTGTGCAGCATCAAGAAGCCCAGGAAGCTGGCCCAGGCCTGCTCCTCTGTGTTTCCCCA

TGGGCAGCGATAGAGGCCAAGTATCTTGTGGGCACTCCTGCCTAACCCTGCATTGGGATATCGAAGCACTGCTTAGGTTCTGAGGTGTGGGTTCCCTGCC

ACCCAGGCAAACAGGCTGAAGATTCTCACCTTTTCTTTCCAGTGTGATTACACGTGCATTTCCAGGTGCTGATTTGCAGCTCTCTGTTACCTTAATCTAC

TTCAAATGTATTTTTTTTTGTAATCATTCTCTAATCCCACTCTGAGTGTCCCGTGACCCTGCATAATAAAGCAATCACTTTC
Translation
MASPAAGGVVIVGS - UNI26575 - SGLIGRSWAMLFASGGFKVKLYDIEQQQITDALENIR RKEMKSLEQSGSLKGSLSAERQLSLISGCGNLAE

AVEGAVHIQ - UNI17391 - ECVPENLELKKKIFAQLDRIVDDRVILSSSSSCLLPSKLFSGLAHVKQCIVAHP VNPPYYVPLVELVPHPETAPAT

MDRTYALMKKIGQSPVRVLKEIDGFVLNRLQYAVISEAWRLVE EEIVSPSDLDLVMSDGLGMRYAFIGPLETMHLNAEG GVISYCERYSEGMKHVLST

FGPVPEFSGATVERVSE DMCMKVPDDPEHLAARRQWRDDCLMKLSILKYQMQPK

For any suggestions or comments, please send an email to unitrap@crg.es