Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000021948 (Prkcd)
Chromosomal location
Chr 14: 31408544 - 31439396 (-)
Description
protein kinase C, delta Gene [Source:MGI (curated);Acc:Prkcd-002]
RefSeq_dna
NM_011103 
RefSeq_peptide
NP_035233.1 
UniGene
Mm.2314 
MGI
MGI:97598 
Uniprot/SWISSPROT
P28867 
Uniprot/SPTREMBL
Q1MX41 Q1MX40 Q1MX42 Q3TT74 Q1MX43 Q3TGE4 Q3UNG2 Q53YN4 Q80UN7 
Human Ortholog
ENSG00000163932 (PRKCD)
Omim not available
UniTrap UNI19967
Vector Insertion
Chr 14: 31423373 - 31423497
Public Clones not available
Private Clones OST376237 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI38365
Vector Insertion
Chr 14: 31415844 - 31417394
Public Clones (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 34% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000112203
Sequence
ACCCTGCCCACCCTGCCCACCCTGGACAGGCTGGAGTCTGAACTGGCTCTAGGGCCCCCCCTTGGCCTTGAGGGAGACCAATGGGGCGGGTTCTGAGTCT

CACCTGGGTCAGGCTGGCCCTCACTGATTTGTCATCCCCCTCCCACCCCTGCAGCTGGATCTGCAGCCTCAGGCCAAGGTGCTGATGTGTGTGCAGTATT

TCCTGGAGGATGGGG ATTGCAAACAGTCTATGCGTAGTGAGGAGGAGGCAAAGTTTCCAACCATGAACCGTCGTGGAGCCATTAAACAGGCCAAGATCC

ACTACATCAAGAACCACGAGTTTATCGCCACCTTCTTCGGGCAGCCCACCTTCTGTTCTGTGTGCAAAGAGTTTGTCTG GGGCCTCAACAAGCAAGGCT

ACAAATGCAGGC AATGCAACGCTGCCATCCACAAGAAATGCATTGACAAGATTATCGGCCGCTGCACTGGCACTGCCACCAATAGCCGGGACACCATC 

TTCCAGAAAGAACGCTTCAACATCGACATGCCTCACCGATTCAAGGTTTATAACTACATGAGCCCCACCTTCTGTGACCACTGTGGCAGTTTGCTCTGGG

GACTGGTGAAGCAGGGATTAAAGTGTGAAG ATTGTGGCATGAATGTGCACCACAAATGCCGGGAGAAGGTGGCCAACCTGTGTGGTATCAACCAAAAGC

TCTTGGCTGAGGCCTTGAACCAAGTGACCCAG AGATCTTCCCGGAAGCTGGACACAACAGAGTCTGTCGGAATATACCAGGGATTTGAGAAGAAGCCAG

AAGTCTCTGGGAGTGACATCCTAG ACAACAACGGGACCTATGGCAAGATCTGGGAGGGGAGCACCCGGTGCACCCTTGAGAACTTCACCTTCCAAAAAG

TACTTGGCAAAGGCAGCTTTGGCAAG GTGCTGCTGGCAGAGCTGAAGGGCAAAGACAAGTACTTTGCAATCAAGTGTCTGAAGAAGGACGTGGTGTTGA

TTGACGATGATGTAGAGTGTACCATGGTGGAGAAGCGGGTGCTGGCGCTCGCCTGGGAGAGTCCCTTCCTCACCCACCTCATCTGTACCTTCCAGACCAA

G GACCACCTGTTCTTCGTGATGGAGTTTCTCAATGGGGGTGACCTGATGTTCCACATTCAGGACAAAGGCCGCTTCGAACTCTACCGGGCTAC GTTTT

ATGCAGCTGAGATCATCTGCGGACTGCAGTTTCTACACAGCAAAGGCATTATTTACAG GGACCTCAAGCTGGACAATGTGATGCTAGACAGGGACGGCC

ACATCAAGATCGCTGACTTTGGGATGTGCAAAGAGAATATATTTGGGGAGGGCCGGGCCAGCACATTCTGCGGCACTCCTGACTACATCGCCCCTGAG A

TCCTGCAGGGCCTGAAGTACTCCTTCTCGGTGGACTGGTGGTCTTTCGGGGTCCTCCTGTACGAAATGCTCATCGGCCAGTCCCCCTTCCACGGCGACGA

TGAGGACGAGCTCTTCGAGTCCATCCGGGTGGACACACCACACTATCCCCGTTGGATCACCAAGGAATCCAAGGACATCATGGAGAAG CTATTCGAGAG

GGACCCTGACAAGAGGCTGGGAGTAACAGGAAACATCAGGATTCACCCCTTTTTCAAGACTATCAACTGGTCCCTCCTGGAGAAGCGGAAGGTGGAGCCG

CCCTTTAAGCCCAAAGTG CAAGCCTGCTTCCTGACCCCTCCTGGCATGCTGTGTATGTACCACAGCCTCTACTCTTGCATCCTCGCAATCTCAGCCCTG

CACTCATTCAGGAGACAGCTGGAACTGCAGATTTAGGATCTTGAGCTGGGGAATGTAGCTCGGAGGCAGAGCACTTAGCCTAGCATCTACAGGGCCCTAG

GTTTGAATCTCAGCACCACCAAATAAAAACAGCAGAAACAG
Translation
MCVQYFLEDGD DCKQSMRSEEEAKFPTMNRRGAIKQAKIHYIKNHEFIATFFGQPTFCSVCKEFVW WGLNKQGYKCRQ QCNAAIHKKCIDKIIGRCT

GTATNSRDTI FQKERFNIDMPHRFKVYNYMSPTFCDHCGSLLWGLVKQGLKCED DCGMNVHHKCREKVANLCGINQKLLAEALNQVTQ RSSRKLDTT

ESVGIYQGFEKKPEVSGSDILD DNNGTYGKIWEGSTRCTLENFTFQKVLGKGSFGK VLLAELKGKDKYFAIKCLKKDVVLIDDDVECTMVEKRVLALA

WESPFLTHLICTFQTK DHLFFVMEFLNGGDLMFHIQDKGRFELYRAT TFYAAEIICGLQFLHSKGIIYR RDLKLDNVMLDRDGHIKIADFGMCKENI

FGEGRASTFCGTPDYIAPE ILQGLKYSFSVDWWSFGVLLYEMLIGQSPFHGDDEDELFESIRVDTPHYPRWITKESKDIMEK LFERDPDKRLGVTGNI

RIHPFFKTINWSLLEKRKVEPPFKPKV QACFLTPPGMLCMYHSLYSCILAISALHSFRRQLELQI
Transcript ENSMUST00000112202
Sequence
ACCCTGCCCACCCTGCCCACCCTGGACAGGCTGGAGTCTGAACTGGCTCTAGGGCCCCCCCTTGGCCTTGAGGGAGACCAATGGGGCGGGTTCTGAGTCT

CACCTGGGTCAGGCTGGCCCTCACTGATTTGTCATCCCCCTCCCACCCCTGCAGCTGGATCTGCAGCCTCAGGCCAAGGTGCTGATGTGTGTGCAGTATT

TCCTGGAGGATGGGG ATTGCAAACAGTCTATGCGTAGTGAGGAGGAGGCAAAGTTTCCAACCATGAACCGTCGTGGAGCCATTAAACAGGCCAAGATCC

ACTACATCAAGAACCACGAGTTTATCGCCACCTTCTTCGGGCAGCCCACCTTCTGTTCTGTGTGCAAAGAGTTTGTCTG GGGCCTCAACAAGCAAGGCT

ACAAATGCAGGC AATGCAACGCTGCCATCCACAAGAAATGCATTGACAAGATTATCGGCCGCTGCACTGGCACTGCCACCAATAGCCGGGACACCATC 

TTCCAGAAAGAACGCTTCAACATCGACATGCCTCACCGATTCAAGGTTTATAACTACATGAGCCCCACCTTCTGTGACCACTGTGGCAGTTTGCTCTGGG

GACTGGTGAAGCAGGGATTAAAGTGTGAAG ATTGTGGCATGAATGTGCACCACAAATGCCGGGAGAAGGTGGCCAACCTGTGTGGTATCAACCAAAAGC

TCTTGGCTGAGGCCTTGAACCAAGTGACCCAG AGATCTTCCCGGAAGCTGGACACAACAGAGTCTGTCGGAATATACCAGGGATTTGAGAAGAAGCCAG

AAGTCTCTGGGAGTGACATCCTAGGTGAAGCTGGGTCACATATCTCTTTAAAGCTATCATTCCCCAGCAGGGCAAAGGAAAAGGACAGTAGTGAGACCTG

CG ACAACAACGGGACCTATGGCAAGATCTGGGAGGGGAGCACCCGGTGCACCCTTGAGAACTTCACCTTCCAAAAAGTACTTGGCAAAGGCAGCTTTGG

CAAG GTGCTGCTGGCAGAGCTGAAGGGCAAAGACAAGTACTTTGCAATCAAGTGTCTGAAGAAGGACGTGGTGTTGATTGACGATGATGTAGAGTGTAC

CATGGTGGAGAAGCGGGTGCTGGCGCTCGCCTGGGAGAGTCCCTTCCTCACCCACCTCATCTGTACCTTCCAGACCAAG GACCACCTGTTCTTCGTGAT

GGAGTTTCTCAATGGGGGTGACCTGATGTTCCACATTCAGGACAAAGGCCGCTTCGAACTCTACCGGGCTAC GTTTTATGCAGCTGAGATCATCTGCGG

ACTGCAGTTTCTACACAGCAAAGGCATTATTTACAG GGACCTCAAGCTGGACAATGTGATGCTAGACAGGGACGGCCACATCAAGATCGCTGACTTTGG

GATGTGCAAAGAGAATATATTTGGGGAGGGCCGGGCCAGCACATTCTGCGGCACTCCTGACTACATCGCCCCTGAG ATCCTGCAGGGCCTGAAGTACTC

CTTCTCGGTGGACTGGTGGTCTTTCGGGGTCCTCCTGTACGAAATGCTCATCGGCCAGTCCCCCTTCCACGGCGACGATGAGGACGAGCTCTTCGAGTCC

ATCCGGGTGGACACACCACACTATCCCCGTTGGATCACCAAGGAATCCAAGGACATCATGGAGAAG CTATTCGAGAGGGACCCTGACAAGAGGCTGGGA

GTAACAGGAAACATCAGGATTCACCCCTTTTTCAAGACTATCAACTGGTCCCTCCTGGAGAAGCGGAAGGTGGAGCCGCCCTTTAAGCCCAAAGTG CAA

GCCTGCTTCCTGACCCCTCCTGGCATGCTGTGTATGTACCACAGCCTCTACTCTTGCATCCTCGCAATCTCAGCCCTGCACTCATTCAGGAGACAGCTGG

AACTGCAGATTTAGGATCTTGAGCTGGGGAATGTAGCTCGGAGGCAGAGCACTTAGCCTAGCATCTACAGGGCCCTAGGTTTGAATCTCAGCACCACCAA

ATAAAAACAGCAGAAACAG
Translation
MCVQYFLEDGD DCKQSMRSEEEAKFPTMNRRGAIKQAKIHYIKNHEFIATFFGQPTFCSVCKEFVW WGLNKQGYKCRQ QCNAAIHKKCIDKIIGRCT

GTATNSRDTI FQKERFNIDMPHRFKVYNYMSPTFCDHCGSLLWGLVKQGLKCED DCGMNVHHKCREKVANLCGINQKLLAEALNQVTQ RSSRKLDTT

ESVGIYQGFEKKPEVSGSDILGEAGSHISLKLSFPSRAKEKDSSETCD DNNGTYGKIWEGSTRCTLENFTFQKVLGKGSFGK VLLAELKGKDKYFAIK

CLKKDVVLIDDDVECTMVEKRVLALAWESPFLTHLICTFQTK DHLFFVMEFLNGGDLMFHIQDKGRFELYRAT TFYAAEIICGLQFLHSKGIIYR RD

LKLDNVMLDRDGHIKIADFGMCKENIFGEGRASTFCGTPDYIAPE ILQGLKYSFSVDWWSFGVLLYEMLIGQSPFHGDDEDELFESIRVDTPHYPRWIT

KESKDIMEK LFERDPDKRLGVTGNIRIHPFFKTINWSLLEKRKVEPPFKPKV QACFLTPPGMLCMYHSLYSCILAISALHSFRRQLELQI
Transcript ENSMUST00000112204
Sequence
GCACTTCCGTGTGCCGCGGCGCCAGAGCAGGAGGCGGCGGCCGCGGGGATCCCGCGAGCGGCCCGTGGACATCTACCCTTCGAGCCGGGACCCGGGAGGT

CCCCACTGGCCTCCGGACCCGTCCGGATCAGACTTGTGCCTACCTCCCCGTCCACGCGCATCCGGGAGAGCCGCGCCACGAGACGGACCCCGGCTCGCCG

GGACCCCTGGCGCCTGGCCCTGCGTCGGGAG - UNI19967 - GCTCCATCATGGCACCCTTCCTGCGCATCTCCTTCAATTCCTATGAGCTGGGCTC

CCTGCAAGTTGAGGACGAAGCAAGCCAGCCTTTCTGTGCTGTGAAGATGAAGGAGGCACTCAGCACAG - UNI19967 - AGCGAGGGAAGACACTGG

TACAGAAGAAGCCCACCATGTATCCTGAGTGGAAGACAACGTTCGACGCCCACATCTATGAAGGCCGTGTTATCCAGATTGTGCTGATGCGGGCAGCTGA

AGACCCCGTGTCTGAGGTCACGGTGGGCGTGTCAGTACTGGCTGAGCGCTGCAAGAAGAACAACGGCAAGGCTGAGTTCTGG CTGGATCTGCAGCCTCA

GGCCAAGGTGCTGATGTGTGTGCAGTATTTCCTGGAGGATGGGG ATTGCAAACAGTCTATGCGTAGTGAGGAGGAGGCAAAGTTTCCAACCATGAACCG

TCGTGGAGCCATTAAACAGGCCAAGATCCACTACATCAAGAACCACGAGTTTATCGCCACCTTCTTCGGGCAGCCCACCTTCTGTTCTGTGTGCAAAGAG

TTTGTCTG GGGCCTCAACAAGCAAGGCTACAAATGCAGGC AATGCAACGCTGCCATCCACAAGAAATGCATTGACAAGATTATCGGCCGCTGCACTGG

CACTGCCACCAATAGCCGGGACACCATC TTCCAGAAAGAACGCTTCAACATCGACATGCCTCACCGATTCAAGGTTTATAACTACATGAGCCCCACCTT

CTGTGACCACTGTGGCAGTTTGCTCTGGGGACTGGTGAAGCAGGGATTAAAGTGTGAAG ATTGTGGCATGAATGTGCACCACAAATGCCGGGAGAAGGT

GGCCAACCTGTGTGGTATCAACCAAAAGCTCTTGGCTGAGGCCTTGAACCAAGTGACCCAG AGATCTTCCCGGAAGCTGGACACAACAGAGTCTGTCGG

AATATACCAGGGATTTGAGAAGAAGCCAGAAGTCTCTGGGAGTGACATCCTAGGTGAAGCTGGGTCACATATCTCTTTAAAGCTATCATTCCCCAGCAGG

GCAAAGGAAAAGGACAGTAGTGAGACCTGCG ACAACAACGGGACCTATGGCAAGATCTGGGAGGGGAGCACCCGGTGCACCCTTGAGAACTTCACCTTC

CAAAAAGTACTTGGCAAAGGCAGCTTTGGCAAG GTGCTGCTGGCAGAGCTGAAGGGCAAAGACAAGTACTTTGCAATCAAGTGTCTGAAGAAGGACGTG

GTGTTGATTGACGATGATGTAGAGTGTACCATGGTGGAGAAGCGGGTGCTGGCGCTCGCCTGGGAGAGTCCCTTCCTCACCCACCTCATCTGTACCTTCC

AGACCAAG GACCACCTGTTCTTCGTGATGGAGTTTCTCAATGGGGGTGACCTGATGTTCCACATTCAGGACAAAGGCCGCTTCGAACTCTACCGGGCTA

C GTTTTATGCAGCTGAGATCATCTGCGGACTGCAGTTTCTACACAGCAAAGGCATTATTTACAG GGACCTCAAGCTGGACAATGTGATGCTAGACAGG

GACGGCCACATCAAGATCGCTGACTTTGGGATGTGCAAAGAGAATATATTTGGGGAGGGCCGGGCCAGCACATTCTGCGGCACTCCTGACTACATCGCCC

CTGAG ATCCTGCAGGGCCTGAAGTACTCCTTCTCGGTGGACTGGTGGTCTTTCGGGGTCCTCCTGTACGAAATGCTCATCGGCCAGTCCCCCTTCCACG

GCGACGATGAGGACGAGCTCTTCGAGTCCATCCGGGTGGACACACCACACTATCCCCGTTGGATCACCAAGGAATCCAAGGACATCATGGAGAAG CTAT

TCGAGAGGGACCCTGACAAGAGGCTGGGAGTAACAGGAAACATCAGGATTCACCCCTTTTTCAAGACTATCAACTGGTCCCTCCTGGAGAAGCGGAAGGT

GGAGCCGCCCTTTAAGCCCAAAGTG CAAGCCTGCTTCCTGACCCCTCCTGGCATGCTGTGTATGTACCACAGCCTCTACTCTTGCATCCTCGCAATCTC

AGCCCTGCACTCATTCAGGAGACAGCTGGAACTGCAGATTTAG
Translation
 - UNI19967 -  - UNI19967 -  MCVQYFLEDGD DCKQSMRSEEEAKFPTMNRRGAIKQAKIHYIKNHEFIATFFGQPTFCSVCKEFVW WGL

NKQGYKCRQ QCNAAIHKKCIDKIIGRCTGTATNSRDTI FQKERFNIDMPHRFKVYNYMSPTFCDHCGSLLWGLVKQGLKCED DCGMNVHHKCREKVA

NLCGINQKLLAEALNQVTQ RSSRKLDTTESVGIYQGFEKKPEVSGSDILGEAGSHISLKLSFPSRAKEKDSSETCD DNNGTYGKIWEGSTRCTLENFT

FQKVLGKGSFGK VLLAELKGKDKYFAIKCLKKDVVLIDDDVECTMVEKRVLALAWESPFLTHLICTFQTK DHLFFVMEFLNGGDLMFHIQDKGRFELY

RAT TFYAAEIICGLQFLHSKGIIYR RDLKLDNVMLDRDGHIKIADFGMCKENIFGEGRASTFCGTPDYIAPE ILQGLKYSFSVDWWSFGVLLYEMLI

GQSPFHGDDEDELFESIRVDTPHYPRWITKESKDIMEK LFERDPDKRLGVTGNIRIHPFFKTINWSLLEKRKVEPPFKPKV QACFLTPPGMLCMYHSL

YSCILAISALHSFRRQLELQI
Transcript ENSMUST00000112206
Sequence
ACCCTGCCCACCCTGCCCACCCTGGACAGGCTGGAGTCTGAACTGGCTCTAGGGCCCCCCCTTGGCCTTGAGGGAGACCAATGGGGCGGGTTCTGAGTCT

CACCTGGGTCAGGCTGGCCCTCACTGATTTGTCATCCCCCTCCCACCCCTGCAGCTGGATCTGCAGCCTCAGGCCAAGGTGCTGATGTGTGTGCAGTATT

TCCTGGAGGATGGGG ATTGCAAACAGTCTATGCGTAGTGAGGAGGAGGCAAAGTTTCCAACCATGAACCGTCGTGGAGCCATTAAACAGGCCAAGATCC

ACTACATCAAGAACCACGAGTTTATCGCCACCTTCTTCGGGCAGCCCACCTTCTGTTCTGTGTGCAAAGAGTTTGTCTG GGGCCTCAACAAGCAAGGCT

ACAAATGCAGGC AATGCAACGCTGCCATCCACAAGAAATGCATTGACAAGATTATCGGCCGCTGCACTGGCACTGCCACCAATAGCCGGGACACCATC 

TTCCAGAAAGAACGCTTCAACATCGACATGCCTCACCGATTCAAGGTTTATAACTACATGAGCCCCACCTTCTGTGACCACTGTGGCAGTTTGCTCTGGG

GACTGGTGAAGCAGGGATTAAAGTGTGAAG ATTGTGGCATGAATGTGCACCACAAATGCCGGGAGAAGGTGGCCAACCTGTGTGGTATCAACCAAAAGC

TCTTGGCTGAGGCCTTGAACCAAGTGACCCAG AGATCTTCCCGGAAGCTGGACACAACAGAGTCTGTCGGAATATACCAGGGATTTGAGAAGAAGCCAG

AAGTCTCTGGGAGTGACATCCTAGGTGAAGCTGGGTCACATATCTCTTTAAAGCTATCATTCCCCAGCAGGGCAAAGGAAAAGGACAGTAGTGAGACCTG

CG ACAACAACGGGACCTATGGCAAGATCTGGGAGGGGAGCACCCGGTGCACCCTTGAGAACTTCACCTTCCAAAAAGTACTTGGCAAAGGCAGCTTTGG

CAAG GTGCTGCTGGCAGAGCTGAAGGGCAAAGACAAGTACTTTGCAATCAAGTGTCTGAAGAAGGACGTGGTGTTGATTGACGATGATGTAGAGTGTAC

CATGGTGGAGAAGCGGGTGCTGGCGCTCGCCTGGGAGAGTCCCTTCCTCACCCACCTCATCTGTACCTTCCAGACCAAG GACCACCTGTTCTTCGTGAT

GGAGTTTCTCAATGGGGGTGACCTGATGTTCCACATTCAGGACAAAGGCCGCTTCGAACTCTACCGGGCTAC GTTTTATGCAGCTGAGATCATCTGCGG

ACTGCAGTTTCTACACAGCAAAGGCATTATTTACAG GGACCTCAAGCTGGACAATGTGATGCTAGACAGGGACGGCCACATCAAGATCGCTGACTTTGG

GATGTGCAAAGAGAATATATTTGGGGAGGGCCGGGCCAGCACATTCTGCGGCACTCCTGACTACATCGCCCCTGAG ATCCTGCAGGGCCTGAAGTACTC

CTTCTCGGTGGACTGGTGGTCTTTCGGGGTCCTCCTGTACGAAATGCTCATCGGCCAGTCCCCCTTCCACGGCGACGATGAGGACGAGCTCTTCGAGTCC

ATCCGGGTGGACACACCACACTATCCCCGTTGGATCACCAAGGAATCCAAGGACATCATGGAGAAG CTATTCGAGAGGGACCCTGACAAGAGGCTGGGA

GTAACAGGAAACATCAGGATTCACCCCTTTTTCAAGACTATCAACTGGTCCCTCCTGGAGAAGCGGAAGGTGGAGCCGCCCTTTAAGCCCAAAGTG AAA

TCCCCTTCAGACTACAGCAACTTTGACCCAGAGTTCCTGAATGAGAAACCTCAGCTTTCCTTCAGTGACAAGAACCTCATCGACTCTATGGACCAGGAAG

CCTTCCATGGCTTCTCCTTTGTGAATCCCAAGTTTGAGCAATTCCTGGACATTTAATTAAGCTCCCAGACCTGCTTTAAACGCCCTGGCAGAGTAGGCCC

GTCTGCCCTGGTTTGCACCGCATTGCCCGTGGAGAACAGTGGGTGACTGGCTGATTTCTGCTGCCACCCCCTCCTCCTTGGAGAGTCCGGCTCCTGCTGG

CTGGGCTCACAGTACTTCCTCTGTGAACTGTTTGTGAATTTGCCTTCCCTTTGCCATCAGAGGGAAACTGTAAATCCTGTGTTTCATTACTTGAATGTAG

TTATTGAAATATATATTATATATATGCAC
Translation
MCVQYFLEDGD DCKQSMRSEEEAKFPTMNRRGAIKQAKIHYIKNHEFIATFFGQPTFCSVCKEFVW WGLNKQGYKCRQ QCNAAIHKKCIDKIIGRCT

GTATNSRDTI FQKERFNIDMPHRFKVYNYMSPTFCDHCGSLLWGLVKQGLKCED DCGMNVHHKCREKVANLCGINQKLLAEALNQVTQ RSSRKLDTT

ESVGIYQGFEKKPEVSGSDILGEAGSHISLKLSFPSRAKEKDSSETCD DNNGTYGKIWEGSTRCTLENFTFQKVLGKGSFGK VLLAELKGKDKYFAIK

CLKKDVVLIDDDVECTMVEKRVLALAWESPFLTHLICTFQTK DHLFFVMEFLNGGDLMFHIQDKGRFELYRAT TFYAAEIICGLQFLHSKGIIYR RD

LKLDNVMLDRDGHIKIADFGMCKENIFGEGRASTFCGTPDYIAPE ILQGLKYSFSVDWWSFGVLLYEMLIGQSPFHGDDEDELFESIRVDTPHYPRWIT

KESKDIMEK LFERDPDKRLGVTGNIRIHPFFKTINWSLLEKRKVEPPFKPKV KSPSDYSNFDPEFLNEKPQLSFSDKNLIDSMDQEAFHGFSFVNPKF

EQFLDI
Transcript ENSMUST00000112207
Sequence
ACCCTGCCCACCCTGCCCACCCTGGACAGGCTGGAGTCTGAACTGGCTCTAGGGCCCCCCCTTGGCCTTGAGGGAGACCAATGGGGCGGGTTCTGAGTCT

CACCTGGGTCAGGCTGGCCCTCACTGATTTGTCATCCCCCTCCCACCCCTGCAGCTGGATCTGCAGCCTCAGGCCAAGGTGCTGATGTGTGTGCAGTATT

TCCTGGAGGATGGGG ATTGCAAACAGTCTATGCGTAGTGAGGAGGAGGCAAAGTTTCCAACCATGAACCGTCGTGGAGCCATTAAACAGGCCAAGATCC

ACTACATCAAGAACCACGAGTTTATCGCCACCTTCTTCGGGCAGCCCACCTTCTGTTCTGTGTGCAAAGAGTTTGTCTG GGGCCTCAACAAGCAAGGCT

ACAAATGCAGGC AATGCAACGCTGCCATCCACAAGAAATGCATTGACAAGATTATCGGCCGCTGCACTGGCACTGCCACCAATAGCCGGGACACCATC 

TTCCAGAAAGAACGCTTCAACATCGACATGCCTCACCGATTCAAGGTTTATAACTACATGAGCCCCACCTTCTGTGACCACTGTGGCAGTTTGCTCTGGG

GACTGGTGAAGCAGGGATTAAAGTGTGAAG ATTGTGGCATGAATGTGCACCACAAATGCCGGGAGAAGGTGGCCAACCTGTGTGGTATCAACCAAAAGC

TCTTGGCTGAGGCCTTGAACCAAGTGACCCAG AGATCTTCCCGGAAGCTGGACACAACAGAGTCTGTCGGAATATACCAGGGATTTGAGAAGAAGCCAG

AAGTCTCTGGGAGTGACATCCTAG ACAACAACGGGACCTATGGCAAGATCTGGGAGGGGAGCACCCGGTGCACCCTTGAGAACTTCACCTTCCAAAAAG

TACTTGGCAAAGGCAGCTTTGGCAAG GTGCTGCTGGCAGAGCTGAAGGGCAAAGACAAGTACTTTGCAATCAAGTGTCTGAAGAAGGACGTGGTGTTGA

TTGACGATGATGTAGAGTGTACCATGGTGGAGAAGCGGGTGCTGGCGCTCGCCTGGGAGAGTCCCTTCCTCACCCACCTCATCTGTACCTTCCAGACCAA

G GACCACCTGTTCTTCGTGATGGAGTTTCTCAATGGGGGTGACCTGATGTTCCACATTCAGGACAAAGGCCGCTTCGAACTCTACCGGGCTAC GTTTT

ATGCAGCTGAGATCATCTGCGGACTGCAGTTTCTACACAGCAAAGGCATTATTTACAG GGACCTCAAGCTGGACAATGTGATGCTAGACAGGGACGGCC

ACATCAAGATCGCTGACTTTGGGATGTGCAAAGAGAATATATTTGGGGAGGGCCGGGCCAGCACATTCTGCGGCACTCCTGACTACATCGCCCCTGAG A

TCCTGCAGGGCCTGAAGTACTCCTTCTCGGTGGACTGGTGGTCTTTCGGGGTCCTCCTGTACGAAATGCTCATCGGCCAGTCCCCCTTCCACGGCGACGA

TGAGGACGAGCTCTTCGAGTCCATCCGGGTGGACACACCACACTATCCCCGTTGGATCACCAAGGAATCCAAGGACATCATGGAGAAG CTATTCGAGAG

GGACCCTGACAAGAGGCTGGGAGTAACAGGAAACATCAGGATTCACCCCTTTTTCAAGACTATCAACTGGTCCCTCCTGGAGAAGCGGAAGGTGGAGCCG

CCCTTTAAGCCCAAAGTG AAATCCCCTTCAGACTACAGCAACTTTGACCCAGAGTTCCTGAATGAGAAACCTCAGCTTTCCTTCAGTGACAAGAACCTC

ATCGACTCTATGGACCAGGAAGCCTTCCATGGCTTCTCCTTTGTGAATCCCAAGTTTGAGCAATTCCTGGACATTTAATTAAGCTCCCAGACCTGCTTTA

AACGCCCTGGCAGAGTAGGCCCGTCTGCCCTGGTTTGCACCGCATTGCCCGTGGAGAACAGTGGGTGACTGGCTGATTTCTGCTGCCACCCCCTCCTCCT

TGGAGAGTCCGGCTCCTGCTGGCTGGGCTCACAGTACTTCCTCTGTGAACTGTTTGTGAATTTGCCTTCCCTTTGCCATCAGAGGGAAACTGTAAATCCT

GTGTTTCATTACTTGAATGTAGTTATTGAAATATATATTATATATATGCACAT
Translation
MCVQYFLEDGD DCKQSMRSEEEAKFPTMNRRGAIKQAKIHYIKNHEFIATFFGQPTFCSVCKEFVW WGLNKQGYKCRQ QCNAAIHKKCIDKIIGRCT

GTATNSRDTI FQKERFNIDMPHRFKVYNYMSPTFCDHCGSLLWGLVKQGLKCED DCGMNVHHKCREKVANLCGINQKLLAEALNQVTQ RSSRKLDTT

ESVGIYQGFEKKPEVSGSDILD DNNGTYGKIWEGSTRCTLENFTFQKVLGKGSFGK VLLAELKGKDKYFAIKCLKKDVVLIDDDVECTMVEKRVLALA

WESPFLTHLICTFQTK DHLFFVMEFLNGGDLMFHIQDKGRFELYRAT TFYAAEIICGLQFLHSKGIIYR RDLKLDNVMLDRDGHIKIADFGMCKENI

FGEGRASTFCGTPDYIAPE ILQGLKYSFSVDWWSFGVLLYEMLIGQSPFHGDDEDELFESIRVDTPHYPRWITKESKDIMEK LFERDPDKRLGVTGNI

RIHPFFKTINWSLLEKRKVEPPFKPKV KSPSDYSNFDPEFLNEKPQLSFSDKNLIDSMDQEAFHGFSFVNPKFEQFLDI
Transcript ENSMUST00000112208
Sequence
GCACTTCCGTGTGCCGCGGCGCCAGAGCAGGAGGCGGCGGCCGCGGGGATCCCGCGAGCGGCCCGTGGACATCTACCCTTCGAGCCGGGACCCGGGAGGT

CCCCACTGGCCTCCGGACCCGTCCGGATCAGACTTGTGCCTACCTCCCCGTCCACGCGCATCCGGGAGAGCCGCGCCACGAGACGGACCCCGGCTCGCCG

GGACCCCTGGCGCCTGGCCCTGCGTCGGGAG AGGCTCCATCATGGCACCCTTCCTGCGCATCTCCTTCAATTCCTATGAGCTGGGCTCCCTGCAAGTTG

AGGACGAAGCAAGCCAGCCTTTCTGTGCTGTGAAGATGAAGGAGGCACTCAGCACAG - UNI19967 - AGCGAGGGAAGACACTGGTACAGAAGAAG

CCCACCATGTATCCTGAGTGGAAGACAACGTTCGACGCCCACATCTATGAAGGCCGTGTTATCCAGATTGTGCTGATGCGGGCAGCTGAAGACCCCGTGT

CTGAGGTCACGGTGGGCGTGTCAGTACTGGCTGAGCGCTGCAAGAAGAACAACGGCAAGGCTGAGTTCTGG CTGGATCTGCAGCCTCAGGCCAAGGTGC

TGATGTGTGTGCAGTATTTCCTGGAGGATGGGG ATTGCAAACAGTCTATGCGTAGTGAGGAGGAGGCAAAGTTTCCAACCATGAACCGTCGTGGAGCCA

TTAAACAGGCCAAGATCCACTACATCAAGAACCACGAGTTTATCGCCACCTTCTTCGGGCAGCCCACCTTCTGTTCTGTGTGCAAAGAGTTTGTCTG GG

GCCTCAACAAGCAAGGCTACAAATGCAGGC AATGCAACGCTGCCATCCACAAGAAATGCATTGACAAGATTATCGGCCGCTGCACTGGCACTGCCACCA

ATAGCCGGGACACCATC TTCCAGAAAGAACGCTTCAACATCGACATGCCTCACCGATTCAAGGTTTATAACTACATGAGCCCCACCTTCTGTGACCACT

GTGGCAGTTTGCTCTGGGGACTGGTGAAGCAGGGATTAAAGTGTGAAG ATTGTGGCATGAATGTGCACCACAAATGCCGGGAGAAGGTGGCCAACCTGT

GTGGTATCAACCAAAAGCTCTTGGCTGAGGCCTTGAACCAAGTGACCCAG AGATCTTCCCGGAAGCTGGACACAACAGAGTCTGTCGGAATATACCAGG

GATTTGAGAAGAAGCCAGAAGTCTCTGGGAGTGACATCCTAG ACAACAACGGGACCTATGGCAAGATCTGGGAGGGGAGCACCCGGTGCACCCTTGAGA

ACTTCACCTTCCAAAAAGTACTTGGCAAAGGCAGCTTTGGCAAG GTGCTGCTGGCAGAGCTGAAGGGCAAAGACAAGTACTTTGCAATCAAGTGTCTGA

AGAAGGACGTGGTGTTGATTGACGATGATGTAGAGTGTACCATGGTGGAGAAGCGGGTGCTGGCGCTCGCCTGGGAGAGTCCCTTCCTCACCCACCTCAT

CTGTACCTTCCAGACCAAG GACCACCTGTTCTTCGTGATGGAGTTTCTCAATGGGGGTGACCTGATGTTCCACATTCAGGACAAAGGCCGCTTCGAACT

CTACCGGGCTAC GTTTTATGCAGCTGAGATCATCTGCGGACTGCAGTTTCTACACAGCAAAGGCATTATTTACAG GGACCTCAAGCTGGACAATGTGA

TGCTAGACAGGGACGGCCACATCAAGATCGCTGACTTTGGGATGTGCAAAGAGAATATATTTGGGGAGGGCCGGGCCAGCACATTCTGCGGCACTCCTGA

CTACATCGCCCCTGAG ATCCTGCAGGGCCTGAAGTACTCCTTCTCGGTGGACTGGTGGTCTTTCGGGGTCCTCCTGTACGAAATGCTCATCGGCCAGTC

CCCCTTCCACGGCGACGATGAGGACGAGCTCTTCGAGTCCATCCGGGTGGACACACCACACTATCCCCGTTGGATCACCAAGGAATCCAAGGACATCATG

GAGAAG CTATTCGAGAGGGACCCTGACAAGAGGCTGGGAGTAACAGGAAACATCAGGATTCACCCCTTTTTCAAGACTATCAACTGGTCCCTCCTGGAG

AAGCGGAAGGTGGAGCCGCCCTTTAAGCCCAAAGTG AAATCCCCTTCAGACTACAGCAACTTTGACCCAGAGTTCCTGAATGAGAAACCTCAGCTTTCC

TTCAGTGACAAGAACCTCATCGACTCTATGGACCAGGAAGCCTTCCATGGCTTCTCCTTTGTGAATCCCAAGTTTGAGCAATTCCTGGACATTTAATTAA

GCTCCCAGACCTGCTTTAAACGCCCTGGCAGAGTAGGCCCGTCTGCCCTGGTTTGCACCGCATTGCCCGTGGAGAACAGTGGGTGACTGGCTGATTTCTG

CTGCCACCCCCTCCTCCTTGGAGAGTCCGGCTCCTGCTGGCTGGGCTCACAGTACTTCCTCTGTGAACTGTTTGTGAATTTGCCTTCCCTTTGCCATCAG

AGGGAAACTGTAAATCCTGTGTTTCATTACTTGAATGTAGTTATTGAAATATATATTATATATATGCACATATATATAATAGGCTGTATATATTGCTCAG

TATAGAAAGCATGTAGGAGACTGGTGATGTGTTGACCTTTTTAAAAAAAAACATATGTATATGTGTGTATATATATATACACACATATACATATATATGT

GTATGTATGTACGTATGTATATATATATGACCAAAAGAAAAGAAGAGCACAAGCTGTCTGAACCACAGGTTCTTTTATGTGTGTCTAAATAAAC
Translation
 MAPFLRISFNSYELGSLQVEDEASQPFCAVKMKEALSTE - UNI19967 - ERGKTLVQKKPTMYPEWKTTFDAHIYEGRVIQIVLMRAAEDPVSEV

TVGVSVLAERCKKNNGKAEFW LDLQPQAKVLMCVQYFLEDGD DCKQSMRSEEEAKFPTMNRRGAIKQAKIHYIKNHEFIATFFGQPTFCSVCKEFVW 

WGLNKQGYKCRQ QCNAAIHKKCIDKIIGRCTGTATNSRDTI FQKERFNIDMPHRFKVYNYMSPTFCDHCGSLLWGLVKQGLKCED DCGMNVHHKCRE

KVANLCGINQKLLAEALNQVTQ RSSRKLDTTESVGIYQGFEKKPEVSGSDILD DNNGTYGKIWEGSTRCTLENFTFQKVLGKGSFGK VLLAELKGKD

KYFAIKCLKKDVVLIDDDVECTMVEKRVLALAWESPFLTHLICTFQTK DHLFFVMEFLNGGDLMFHIQDKGRFELYRAT TFYAAEIICGLQFLHSKGI

IYR RDLKLDNVMLDRDGHIKIADFGMCKENIFGEGRASTFCGTPDYIAPE ILQGLKYSFSVDWWSFGVLLYEMLIGQSPFHGDDEDELFESIRVDTPH

YPRWITKESKDIMEK LFERDPDKRLGVTGNIRIHPFFKTINWSLLEKRKVEPPFKPKV KSPSDYSNFDPEFLNEKPQLSFSDKNLIDSMDQEAFHGFS

FVNPKFEQFLDI
Transcript ENSMUST00000022521
Sequence
ATGGCACCCTTCCTGCGCATCTCCTTCAATTCCTATGAGCTGGGCTCCCTGCAAGTTGAGGACGAAGCAAGCCAGCCTTTCTGTGCTGTGAAGATGAAGG

AGGCACTCAGCACAG - UNI19967 - AGCGAGGGAAGACACTGGTACAGAAGAAGCCCACCATGTATCCTGAGTGGAAGACAACGTTCGACGCCCAC

ATCTATGAAGGCCGTGTTATCCAGATTGTGCTGATGCGGGCAGCTGAAGACCCCGTGTCTGAGGTCACGGTGGGCGTGTCAGTACTGGCTGAGCGCTGCA

AGAAGAACAACGGCAAGGCTGAGTTCTGG CTGGATCTGCAGCCTCAGGCCAAGGTGCTGATGTGTGTGCAGTATTTCCTGGAGGATGGGG ATTGCAAA

CAGTCTATGCGTAGTGAGGAGGAGGCAAAGTTTCCAACCATGAACCGTCGTGGAGCCATTAAACAGGCCAAGATCCACTACATCAAGAACCACGAGTTTA

TCGCCACCTTCTTCGGGCAGCCCACCTTCTGTTCTGTGTGCAAAGAGTTTGTCTG GGGCCTCAACAAGCAAGGCTACAAATGCAGGC AATGCAACGCT

GCCATCCACAAGAAATGCATTGACAAGATTATCGGCCGCTGCACTGGCACTGCCACCAATAGCCGGGACACCATC TTCCAGAAAGAACGCTTCAACATC

GACATGCCTCACCGATTCAAGGTTTATAACTACATGAGCCCCACCTTCTGTGACCACTGTGGCAGTTTGCTCTGGGGACTGGTGAAGCAGGGATTAAAGT

GTGAAG ATTGTGGCATGAATGTGCACCACAAATGCCGGGAGAAGGTGGCCAACCTGTGTGGTATCAACCAAAAGCTCTTGGCTGAGGCCTTGAACCAAG

TGACCCAG AGATCTTCCCGGAAGCTGGACACAACAGAGTCTGTCGGAATATACCAGGGATTTGAGAAGAAGCCAGAAGTCTCTGGGAGTGACATCCTAG

GTGAAGCTGGGTCACATATCTCTTTAAAGCTATCATTCCCCAGCAGGGCAAAGGAAAAGGACAGTAGTGAGACCTGCG ACAACAACGGGACCTATGGCA

AGATCTGGGAGGGGAGCACCCGGTGCACCCTTGAGAACTTCACCTTCCAAAAAGTACTTGGCAAAGGCAGCTTTGGCAAG GTGCTGCTGGCAGAGCTGA

AGGGCAAAGACAAGTACTTTGCAATCAAGTGTCTGAAGAAGGACGTGGTGTTGATTGACGATGATGTAGAGTGTACCATGGTGGAGAAGCGGGTGCTGGC

GCTCGCCTGGGAGAGTCCCTTCCTCACCCACCTCATCTGTACCTTCCAGACCAAG GACCACCTGTTCTTCGTGATGGAGTTTCTCAATGGGGGTGACCT

GATGTTCCACATTCAGGACAAAGGCCGCTTCGAACTCTACCGGGCTAC GTTTTATGCAGCTGAGATCATCTGCGGACTGCAGTTTCTACACAGCAAAGG

CATTATTTACAG GGACCTCAAGCTGGACAATGTGATGCTAGACAGGGACGGCCACATCAAGATCGCTGACTTTGGGATGTGCAAAGAGAATATATTTGG

GGAGGGCCGGGCCAGCACATTCTGCGGCACTCCTGACTACATCGCCCCTGAG ATCCTGCAGGGCCTGAAGTACTCCTTCTCGGTGGACTGGTGGTCTTT

CGGGGTCCTCCTGTACGAAATGCTCATCGGCCAGTCCCCCTTCCACGGCGACGATGAGGACGAGCTCTTCGAGTCCATCCGGGTGGACACACCACACTAT

CCCCGTTGGATCACCAAGGAATCCAAGGACATCATGGAGAAG CTATTCGAGAGGGACCCTGACAAGAGGCTGGGAGTAACAGGAAACATCAGGATTCAC

CCCTTTTTCAAGACTATCAACTGGTCCCTCCTGGAGAAGCGGAAGGTGGAGCCGCCCTTTAAGCCCAAAGTG AAATCCCCTTCAGACTACAGCAACTTT

GACCCAGAGTTCCTGAATGAGAAACCTCAGCTTTCCTTCAGTGACAAGAACCTCATCGACTCTATGGACCAGGAAGCCTTCCATGGCTTCTCCTTTGTGA

ATCCCAAGTTTGAGCAATTCCTGGACATTTAATTAAGCTCCCAGACCTGCTTTAAACGCCCTGGCAGAGTAGGCCCGTCTGCCCTGGTTTGCACCGCATT

GCCCGTGGAGAACAGTGGGTGACTGGCTGATTTCTGCTGCCACCCCCTCCTCCTTGGAGAGTCCGGCTCCTGCTGGCTGGGCTCACAGTACTTCCTCTGT

GAACTGTTTGTGAATTTGCCTTCCCTTTGCCATCAGAGGGAAACTGTAAATCCTGTGTTTCATTACTTGAATGTAGTTATTGAAATATATATTATATATA

TGCACATATATATAATAGGCTGTATATATTGCTCAGTATAGAAAGCATGTAGGAGACTGGTGATGTGTTGACCTTTTTAAAAAAAAACATATGTATATGT

GTGTATATATATATACACACATATACATATATATGTGTATGTATGTACGTATGTATATATATATGACCAAAAGAAAAGAAGAGCACAAGCTGTCTGAACC

ACAGGTTCTTTTATGTGTGTCTAAATAAACACTGAATGGTA
Translation
MAPFLRISFNSYELGSLQVEDEASQPFCAVKMKEALSTE - UNI19967 - ERGKTLVQKKPTMYPEWKTTFDAHIYEGRVIQIVLMRAAEDPVSEVT

VGVSVLAERCKKNNGKAEFW LDLQPQAKVLMCVQYFLEDGD DCKQSMRSEEEAKFPTMNRRGAIKQAKIHYIKNHEFIATFFGQPTFCSVCKEFVW W

GLNKQGYKCRQ QCNAAIHKKCIDKIIGRCTGTATNSRDTI FQKERFNIDMPHRFKVYNYMSPTFCDHCGSLLWGLVKQGLKCED DCGMNVHHKCREK

VANLCGINQKLLAEALNQVTQ RSSRKLDTTESVGIYQGFEKKPEVSGSDILGEAGSHISLKLSFPSRAKEKDSSETCD DNNGTYGKIWEGSTRCTLEN

FTFQKVLGKGSFGK VLLAELKGKDKYFAIKCLKKDVVLIDDDVECTMVEKRVLALAWESPFLTHLICTFQTK DHLFFVMEFLNGGDLMFHIQDKGRFE

LYRAT TFYAAEIICGLQFLHSKGIIYR RDLKLDNVMLDRDGHIKIADFGMCKENIFGEGRASTFCGTPDYIAPE ILQGLKYSFSVDWWSFGVLLYEM

LIGQSPFHGDDEDELFESIRVDTPHYPRWITKESKDIMEK LFERDPDKRLGVTGNIRIHPFFKTINWSLLEKRKVEPPFKPKV KSPSDYSNFDPEFLN

EKPQLSFSDKNLIDSMDQEAFHGFSFVNPKFEQFLDI
Transcript ENSMUST00000112210
Sequence
GCACTTCCGTGTGCCGCGGCGCCAGAGCAGGAGGCGGCGGCCGCGGGGATCCCGCGAGCGGCCCGTGGACATCTACCCTTCGAGCCGGGACCCGGGAGGT

CCCCACTGGCCTCCGGACCCGTCCGGATCAGACTTGTGCCTACCTCCCCGTCCACGCGCATCCGGGAGAGCCGCGCCACGAGACGGACCCCGGCTCGCCG

GGACCCCTGGCGCCTGGCCCTGCGTCGGGAG - UNI19967 - GCTCCATCATGGCACCCTTCCTGCGCATCTCCTTCAATTCCTATGAGCTGGGCTC

CCTGCAAGTTGAGGACGAAGCAAGCCAGCCTTTCTGTGCTGTGAAGATGAAGGAGGCACTCAGCACAG - UNI19967 - AGCGAGGGAAGACACTGG

TACAGAAGAAGCCCACCATGTATCCTGAGTGGAAGACAACGTTCGACGCCCACATCTATGAAGGCCGTGTTATCCAGATTGTGCTGATGCGGGCAGCTGA

AGACCCCGTGTCTGAGGTCACGGTGGGCGTGTCAGTACTGGCTGAGCGCTGCAAGAAGAACAACGGCAAGGCTGAGTTCTGG CTGGATCTGCAGCCTCA

GGCCAAGGTGCTGATGTGTGTGCAGTATTTCCTGGAGGATGGGG ATTGCAAACAGTCTATGCGTAGTGAGGAGGAGGCAAAGTTTCCAACCATGAACCG

TCGTGGAGCCATTAAACAGGCCAAGATCCACTACATCAAGAACCACGAGTTTATCGCCACCTTCTTCGGGCAGCCCACCTTCTGTTCTGTGTGCAAAGAG

TTTGTCTG GGGCCTCAACAAGCAAGGCTACAAATGCAGGC AATGCAACGCTGCCATCCACAAGAAATGCATTGACAAGATTATCGGCCGCTGCACTGG

CACTGCCACCAATAGCCGGGACACCATC TTCCAGAAAGAACGCTTCAACATCGACATGCCTCACCGATTCAAGGTTTATAACTACATGAGCCCCACCTT

CTGTGACCACTGTGGCAGTTTGCTCTGGGGACTGGTGAAGCAGGGATTAAAGTGTGAAG ATTGTGGCATGAATGTGCACCACAAATGCCGGGAGAAGGT

GGCCAACCTGTGTGGTATCAACCAAAAGCTCTTGGCTGAGGCCTTGAACCAAGTGACCCAG AGATCTTCCCGGAAGCTGGACACAACAGAGTCTGTCGG

AATATACCAGGGATTTGAGAAGAAGCCAGAAGTCTCTGGGAGTGACATCCTAG ACAACAACGGGACCTATGGCAAGATCTGGGAGGGGAGCACCCGGTG

CACCCTTGAGAACTTCACCTTCCAAAAAGTACTTGGCAAAGGCAGCTTTGGCAAG GTGCTGCTGGCAGAGCTGAAGGGCAAAGACAAGTACTTTGCAAT

CAAGTGTCTGAAGAAGGACGTGGTGTTGATTGACGATGATGTAGAGTGTACCATGGTGGAGAAGCGGGTGCTGGCGCTCGCCTGGGAGAGTCCCTTCCTC

ACCCACCTCATCTGTACCTTCCAGACCAAG GACCACCTGTTCTTCGTGATGGAGTTTCTCAATGGGGGTGACCTGATGTTCCACATTCAGGACAAAGGC

CGCTTCGAACTCTACCGGGCTAC GTTTTATGCAGCTGAGATCATCTGCGGACTGCAGTTTCTACACAGCAAAGGCATTATTTACAG GGACCTCAAGCT

GGACAATGTGATGCTAGACAGGGACGGCCACATCAAGATCGCTGACTTTGGGATGTGCAAAGAGAATATATTTGGGGAGGGCCGGGCCAGCACATTCTGC

GGCACTCCTGACTACATCGCCCCTGAG ATCCTGCAGGGCCTGAAGTACTCCTTCTCGGTGGACTGGTGGTCTTTCGGGGTCCTCCTGTACGAAATGCTC

ATCGGCCAGTCCCCCTTCCACGGCGACGATGAGGACGAGCTCTTCGAGTCCATCCGGGTGGACACACCACACTATCCCCGTTGGATCACCAAGGAATCCA

AGGACATCATGGAGAAG CTATTCGAGAGGGACCCTGACAAGAGGCTGGGAGTAACAGGAAACATCAGGATTCACCCCTTTTTCAAGACTATCAACTGGT

CCCTCCTGGAGAAGCGGAAGGTGGAGCCGCCCTTTAAGCCCAAAGTG AAATCCCCTTCAGACTACAGCAACTTTGACCCAGAGTTCCTGAATGAGAAAC

CTCAGCTTTCCTTCAGTGACAAGAACCTCATCGACTCTATGGACCAGGAAGCCTTCCATGGCTTCTCCTTTGTGAATCCCAAGTTTGAGCAATTCCTGGA

CATTTAATTAAGCTCCCAGACCTGCTTTAAACGCCCTGGCAGAGTAGGCCCGTCTGCCCTGGTTTGCACCGCATTGCCCGTGGAGAACAGTGGGTGACTG

GCTGATTTCTGCTGCCACCCCCTCCTCCTTGGAGAGTCCGGCTCCTGCTGGCTGGGCTCACAGTACTTCCTCTGTGAACTGTTTGTGAATTTGCCTTCCC

TTTGCCATCAGAGGGAAACTGTAAATCCTGTGTTTCATTACTTGAATGTAGTTATTGAAATATATATTATATATATGCACATATATATAATAGGCTGTAT

ATATTGCTCAGTATAGAAAGCATGTAGGAGACTGGTGATGTGTTGACCTTTTTAAAAAAAAACATATGTATATGTGTGTATATATATATACACACATATA

CATATATATGTGTATGTATGTACGTATGTATATATATATGACCAAAAGAAAAGAAGAGCACAAGCTGTCTGAACCACAGGTTCTTTTATGTGTGTCTAAA

TAAACACTGAATGGT
Translation
 - UNI19967 - MAPFLRISFNSYELGSLQVEDEASQPFCAVKMKEALSTE - UNI19967 - ERGKTLVQKKPTMYPEWKTTFDAHIYEGRVIQI

VLMRAAEDPVSEVTVGVSVLAERCKKNNGKAEFW LDLQPQAKVLMCVQYFLEDGD DCKQSMRSEEEAKFPTMNRRGAIKQAKIHYIKNHEFIATFFGQ

PTFCSVCKEFVW WGLNKQGYKCRQ QCNAAIHKKCIDKIIGRCTGTATNSRDTI FQKERFNIDMPHRFKVYNYMSPTFCDHCGSLLWGLVKQGLKCED

 DCGMNVHHKCREKVANLCGINQKLLAEALNQVTQ RSSRKLDTTESVGIYQGFEKKPEVSGSDILD DNNGTYGKIWEGSTRCTLENFTFQKVLGKGSF

GK VLLAELKGKDKYFAIKCLKKDVVLIDDDVECTMVEKRVLALAWESPFLTHLICTFQTK DHLFFVMEFLNGGDLMFHIQDKGRFELYRAT TFYAAE

IICGLQFLHSKGIIYR RDLKLDNVMLDRDGHIKIADFGMCKENIFGEGRASTFCGTPDYIAPE ILQGLKYSFSVDWWSFGVLLYEMLIGQSPFHGDDE

DELFESIRVDTPHYPRWITKESKDIMEK LFERDPDKRLGVTGNIRIHPFFKTINWSLLEKRKVEPPFKPKV KSPSDYSNFDPEFLNEKPQLSFSDKNL

IDSMDQEAFHGFSFVNPKFEQFLDI
Transcript ENSMUST00000112211
Sequence
GCACTTCCGTGTGCCGCGGCGCCAGAGCAGGAGGCGGCGGCCGCGGGGATCCCGCGAGCGGCCCGTGGACATCTACCCTTCGAGCCGGGACCCGGGAGGT

CCCCACTGGCCTCCGGACCCGTCCGGATCAGACTTGTGCCTACCTCCCCGTCCACGCGCATCCGGGAGAGCCGCGCCACGAGACGGACCCCGGCTCGCCG

GGACCCCTGGCGCCTGGCCCTGCGTCGGGAG - UNI19967 - GCTCCATCATGGCACCCTTCCTGCGCATCTCCTTCAATTCCTATGAGCTGGGCTC

CCTGCAAGTTGAGGACGAAGCAAGCCAGCCTTTCTGTGCTGTGAAGATGAAGGAGGCACTCAGCACAG - UNI19967 - AGCGAGGGAAGACACTGG

TACAGAAGAAGCCCACCATGTATCCTGAGTGGAAGACAACGTTCGACGCCCACATCTATGAAGGCCGTGTTATCCAGATTGTGCTGATGCGGGCAGCTGA

AGACCCCGTGTCTGAGGTCACGGTGGGCGTGTCAGTACTGGCTGAGCGCTGCAAGAAGAACAACGGCAAGGCTGAGTTCTGG CTGGATCTGCAGCCTCA

GGCCAAGGTGCTGATGTGTGTGCAGTATTTCCTGGAGGATGGGG ATTGCAAACAGTCTATGCGTAGTGAGGAGGAGGCAAAGTTTCCAACCATGAACCG

TCGTGGAGCCATTAAACAGGCCAAGATCCACTACATCAAGAACCACGAGTTTATCGCCACCTTCTTCGGGCAGCCCACCTTCTGTTCTGTGTGCAAAGAG

TTTGTCTG GGGCCTCAACAAGCAAGGCTACAAATGCAGGC AATGCAACGCTGCCATCCACAAGAAATGCATTGACAAGATTATCGGCCGCTGCACTGG

CACTGCCACCAATAGCCGGGACACCATC TTCCAGAAAGAACGCTTCAACATCGACATGCCTCACCGATTCAAGGTTTATAACTACATGAGCCCCACCTT

CTGTGACCACTGTGGCAGTTTGCTCTGGGGACTGGTGAAGCAGGGATTAAAGTGTGAAG ATTGTGGCATGAATGTGCACCACAAATGCCGGGAGAAGGT

GGCCAACCTGTGTGGTATCAACCAAAAGCTCTTGGCTGAGGCCTTGAACCAAGTGACCCAG AGATCTTCCCGGAAGCTGGACACAACAGAGTCTGTCGG

AATATACCAGGGATTTGAGAAGAAGCCAGAAGTCTCTGGGAGTGACATCCTAGGTGAAGCTGGGTCACATATCTCTTTAAAGCTATCATTCCCCAGCAGG

GCAAAGGAAAAGGACAGTAGTGAGACCTGCG ACAACAACGGGACCTATGGCAAGATCTGGGAGGGGAGCACCCGGTGCACCCTTGAGAACTTCACCTTC

CAAAAAGTACTTGGCAAAGGCAGCTTTGGCAAG GTGCTGCTGGCAGAGCTGAAGGGCAAAGACAAGTACTTTGCAATCAAGTGTCTGAAGAAGGACGTG

GTGTTGATTGACGATGATGTAGAGTGTACCATGGTGGAGAAGCGGGTGCTGGCGCTCGCCTGGGAGAGTCCCTTCCTCACCCACCTCATCTGTACCTTCC

AGACCAAG GACCACCTGTTCTTCGTGATGGAGTTTCTCAATGGGGGTGACCTGATGTTCCACATTCAGGACAAAGGCCGCTTCGAACTCTACCGGGCTA

C GTTTTATGCAGCTGAGATCATCTGCGGACTGCAGTTTCTACACAGCAAAGGCATTATTTACAG GGACCTCAAGCTGGACAATGTGATGCTAGACAGG

GACGGCCACATCAAGATCGCTGACTTTGGGATGTGCAAAGAGAATATATTTGGGGAGGGCCGGGCCAGCACATTCTGCGGCACTCCTGACTACATCGCCC

CTGAG ATCCTGCAGGGCCTGAAGTACTCCTTCTCGGTGGACTGGTGGTCTTTCGGGGTCCTCCTGTACGAAATGCTCATCGGCCAGTCCCCCTTCCACG

GCGACGATGAGGACGAGCTCTTCGAGTCCATCCGGGTGGACACACCACACTATCCCCGTTGGATCACCAAGGAATCCAAGGACATCATGGAGAAG CTAT

TCGAGAGGGACCCTGACAAGAGGCTGGGAGTAACAGGAAACATCAGGATTCACCCCTTTTTCAAGACTATCAACTGGTCCCTCCTGGAGAAGCGGAAGGT

GGAGCCGCCCTTTAAGCCCAAAGTG AAATCCCCTTCAGACTACAGCAACTTTGACCCAGAGTTCCTGAATGAGAAACCTCAGCTTTCCTTCAGTGACAA

GAACCTCATCGACTCTATGGACCAGGAAGCCTTCCATGGCTTCTCCTTTGTGAATCCCAAGTTTGAGCAATTCCTGGACATTTAATTAAGCTCCCAGACC

TGCTTTAAACGCCCTGGCAGAGTAGGCCCGTCTGCCCTGGTTTGCACCGCATTGCCCGTGGAGAACAGTGGGTGACTGGCTGATTTCTGCTGCCACCCCC

TCCTCCTTGGAGAGTCCGGCTCCTGCTGGCTGGGCTCACAGTACTTCCTCTGTGAACTGTTTGTGAATTTGCCTTCCCTTTGCCATCAGAGGGAAACTGT

AAATCCTGTGTTTCATTACTTGAATGTAGTTATTGAAATATATATTATATATATGCACATATATATAATAGGCTGTATATATTGCTCAGTATAGAAAGCA

TGTAGGAGACTGGTGATGTGTTGACCTTTTTAAAAAAAAACATATGTATATGTGTGTATATATATATACACACATATACATATATATGTGTATGTATGTA

CGTATGTATATATATATGACCAAAAGAAAAGAAGAGCACAAGCTGTCTGAACCACAGGTTCTTTTATGTGTGTCTAAATAAACACTGAATGGT
Translation
 - UNI19967 - MAPFLRISFNSYELGSLQVEDEASQPFCAVKMKEALSTE - UNI19967 - ERGKTLVQKKPTMYPEWKTTFDAHIYEGRVIQI

VLMRAAEDPVSEVTVGVSVLAERCKKNNGKAEFW LDLQPQAKVLMCVQYFLEDGD DCKQSMRSEEEAKFPTMNRRGAIKQAKIHYIKNHEFIATFFGQ

PTFCSVCKEFVW WGLNKQGYKCRQ QCNAAIHKKCIDKIIGRCTGTATNSRDTI FQKERFNIDMPHRFKVYNYMSPTFCDHCGSLLWGLVKQGLKCED

 DCGMNVHHKCREKVANLCGINQKLLAEALNQVTQ RSSRKLDTTESVGIYQGFEKKPEVSGSDILGEAGSHISLKLSFPSRAKEKDSSETCD DNNGTY

GKIWEGSTRCTLENFTFQKVLGKGSFGK VLLAELKGKDKYFAIKCLKKDVVLIDDDVECTMVEKRVLALAWESPFLTHLICTFQTK DHLFFVMEFLNG

GDLMFHIQDKGRFELYRAT TFYAAEIICGLQFLHSKGIIYR RDLKLDNVMLDRDGHIKIADFGMCKENIFGEGRASTFCGTPDYIAPE ILQGLKYSF

SVDWWSFGVLLYEMLIGQSPFHGDDEDELFESIRVDTPHYPRWITKESKDIMEK LFERDPDKRLGVTGNIRIHPFFKTINWSLLEKRKVEPPFKPKV K

SPSDYSNFDPEFLNEKPQLSFSDKNLIDSMDQEAFHGFSFVNPKFEQFLDI

For any suggestions or comments, please send an email to unitrap@crg.es