Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000021969 (Zdhhc20)
Chromosomal location
Chr 14: 58451539 - 58509099 (-)
Description
zinc finger, DHHC domain containing 20 Gene [Source:MGI Symbol;Acc:MGI:1923215]
RefSeq_dna
NM_029492 
RefSeq_peptide
NP_083768.4 
UniGene
Mm.29044 Mm.395385 Mm.419505 Mm.467862 
MGI
MGI:1923215 
Uniprot/SWISSPROT
Q5Y5T1 
Human Ortholog
ENSG00000180776 (ZDHHC20)
Omim not available
UniTrap UNI26423
Vector Insertion
Chr 14: 58497297 - 58508899
Public Clones IST13733F11 (tigm) IST14727A9 (tigm) IST12365E2 (tigm) IST14475G9 (tigm)
Private Clones OST118962 (lexicon) OST68501 (lexicon)
Severity of mutation (?) Insertion after 11% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI14567
Vector Insertion
Chr 14: 58492729 - 58497297
Public Clones FHCRC-GT-S6-10C1 (fhcrc)
Private Clones OST395457 (lexicon)
Severity of mutation (?) Insertion after 13% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI16633
Vector Insertion
Chr 14: 58484479 - 58492729
Public Clones IST12107B2 (tigm)
Private Clones OST456598 (lexicon) OST364544 (lexicon) OST303795 (lexicon)
Severity of mutation (?) Insertion after 23% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI9228
Vector Insertion
Chr 14: 58477447 - 58484357
Public Clones RRC224 (baygenomics) PST21050-NL (escells) IST10257E10 (tigm) IST12284B12 (tigm)
Private Clones OST151739 (lexicon) OST149775 (lexicon)
Severity of mutation (?) Insertion after 33% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI19931
Vector Insertion
Chr 14: 58475568 - 58476464
Public Clones not available
Private Clones OST376889 (lexicon) OST194512 (lexicon) OST190481 (lexicon) OST177986 (lexicon)
OST155411 (lexicon)
Severity of mutation (?) Insertion after 43% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI33114
Vector Insertion
Chr 14: 58468981 - 58475568
Public Clones IST14956F2 (tigm) IST14580E1 (tigm) IST10786H3 (tigm) IST12937A12 (tigm)
IST13978C11 (tigm) IST14896E6 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 54% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI13205
Vector Insertion
Chr 14: 58465900 - 58468981
Public Clones CMHD-GT_346H3-3 (cmhd)
Private Clones OST383808 (lexicon) OST308717 (lexicon) OST253108 (lexicon) OST111797 (lexicon)
OST102592 (lexicon)
Severity of mutation (?) Insertion after 54% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI20515
Vector Insertion
Chr 14: 58462152 - 58465757
Public Clones not available
Private Clones OST360132 (lexicon) OST356558 (lexicon) OST346607 (lexicon) OST205009 (lexicon)
Severity of mutation (?) Insertion after 67% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI20532
Vector Insertion
Chr 14: 58458043 - 58459665
Public Clones not available
Private Clones OST359657 (lexicon) OST174905 (lexicon)
Severity of mutation (?) Insertion after 86% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000089473
Sequence
GGGGAAGCTGGCGACAGGGCCGCTGGGGTCTTGTGGTCCTACAGAATCGTGGGCAGCGGGACCCGGCAGTCAGCAGAGGAACATGGCGCCCTGGACACTC

TGGCGCTGCTGCCAACGCGTGGTGGGCTGGGTTCCGGTGCTCTTCATCACCTTTGTGGTCGTCTGGTCCTACTACGCGTACGTGGTGGAGCTGTGCGTGA

 - UNI14567 - - UNI26423 - GTACTATTTCCAGAACAGGAGAGAAAG - UNI14567 - GAAAGACCGTTGTTTACCTTGTGGCTTTCCAT

CTGTTCTTTGTTATGTTTGTATGGTCTTATTGGATGACAATATTCACGTCTCCTGCTAGCCCTTCCAAAGAG - UNI14567 - - UNI16633 - T

TCTACTTGTCAAACTCTGAGAAGGAGCGTTATGAGAAGGAGTTCAGCCAAGAAAGACAGCAAGACATTTTGAGAAGAGCGGCAAGAGACCTGCCTATCTA

CACCACATCAGCTTCAAAGG - UNI9228 - CTATCCGATATTGTGAAAAATGTCAGTTGATTAAACCTGACCGAGCCCATCACTGCTCAGCATGTGA

CAG ATGTGTTCTTAAGATGGATCATCACTGTCCATG - UNI19931 - - UNI33114 - GGTGAATAACTGTGTGGGATTTACTAATTACAAATT

CTTCATGCTGTTTTTGTTGTATTCTCTACTATATTGCCTTTTTGTGGCTGCAACAGTTTTAGAGTATTTTATAAAATTTTGGACG - UNI13205 - -

 UNI33114 - AATGAACCAACAGTTTTAAATTTCCCCAGCGCAAAGTTCCACGTACTGTTCCTTTTTTTTGTGTCTGCAATGTTCTTCGTCAGTGTGC

TCTCACTATTTAGCTACCATTGCTGGCTGGTTGGAAAAAATAGAACGACAATAG - UNI20515 - AATCATTTCGTGCACCTATGTTTTCTTATGGA

ATAGATGGAAATGGTTTCTCTCTTGGATGCAGTAAAAATTGGAGACAAGTCTTTGGTGATGAAAAGAAATATTGGCTAGTTCCAATATTCTCAAG TTTG

GGTGATGGTTGCAGTTTTCCAGCTCGCCTTGTGGGGATGGATCCAGAACAAGCTTCTGTTGCAAACCAGAGTGACTACGTCAGAAG - UNI20532 - 

TATTGGCTCAAATCAACCTTTTCCTATCAAACCACTTAGTGAATCAAAAAACCGCTTATTGGACAGTGAATCTCAGTGGCTAGAGAATGGAGCTGAAGAA

GGAGTCACCAAATCAG GGACAAATAACCATGTTACAGTGGAAATAGAAAATTGAGTACTACTTGTTCATAACTAACCATTTGATGAGTGCAAG GTATA

TAAAAACACATTTTGGACTATTTTCAATTTTATTTGCAAGAAAATGATGGATGGAATGAAATACTTGAAGTGTAACAGAAGATATATTTTTAAAAGGAAA

TGTTTGTACAGTTTGATGGATCCACAGAAGCACTGCAGAGCGGAAAGATGCCTTAATTTTTAGTGTCCATTTGTGTGACATTGCCTCACAGCTCAAAAGT

GACTTAATTTTCCTTTGGAAATAACACCTGTTTTACAATGCTATCGTCACGTGTTAACATGCCATATGTATTTTAAACATCTGAGTTACAACATTAGAGC

TATTTCTTAGTATCCACATAAATTTTCACCCCAAAAACACAAACTAAAAAGTTGTCTGTGGTGAAGTATACCTAGGGAAAACGGGGGCTAAAAATGATGC

CCAAATCACTGATTCTTGTGCTGTATAAGGGAAAGAAATACCGCTTTTTTTATTAGATGTTTACTAATTTATAATTACTGTTTTATACTTTTCAACATTT

TAATAAAGATTTTTTAATTATTGGCTATAAAATAACACTCAAAGAAGGATTCAGGTACCTAAATATAATCATTTAGAACATTGAAGATATTAATATAATT

CAGTGAAGGTTTAGTTAGAAGCATTAATACTTCTAATTAGTACTTTTAAAAGCCAAGTGGCACATGCCTATAATCCCAGCATTCAGAAGGCTGAGGTAAT

ATTCTGTGATTTTGAGTCTAGCATTGGTTGCATAGAGACCGTATCTAAAACACAGAATAATACAGCCATGTGGTGTAGTGTGAGCCCAAGGCTCAAAGGA

AACATGGTAGGAAACAACTACACGTTGGTATTCTCTGCTCTTTAATTACTAGTTGTTGAGTGTTCAAGGGAAGTTTTTATGGGCAGGGAAGCACAGAGGT

TCACGTGCTATCCAAAGACCTAACACATATATGAATAGGTGGGAGTGACTAGAAAAAAAGAGAATGAAAGAAGGAGTATTATAAACAAGTAAACAAATTT

TCATCCCTAAAAGTATATAGACTACAACATGCTATTAAATAGGATTTCATTTAGGCAATGTCTAAAAATTACTGTGGTCGTTTACAGGAATCCTGTAGCC

GAGTCAACAGCAACTCAAATGCAGTTCAGATAAGGATGAAATATGTAAAACAAAACCACGACGTCCCAGGCTTGGGCTGGAGAAATGTCTCAGTAGATAA

AGGCCCTTGCCCTCAGACCTACAACCTGACATCAGCCACATTCTGGAAGAAGATACCTAACTCCCACACATTGTCCTCTGGCATTTACATGTGCACTATG

GTGCACATAGACTCTTTAAAAGATAGTACGTTTTTAGCGTCTAGTGGCTTTAATAGAAATGGCTGTATTGAGGAGATTAGTCCACTGGTCTGTCAAAAGG

CAATGTAGAGATGCTATTTTTGGTTTATACCGTTTATCAAAGAAACAAACGCCAGGCGTGGTGGCGCACGCCTTTAATCCCAGCACTTGGGAGGCAGAGG

CAGGTGGATTTCTGAGTTCGAGGCCGGCCTGGTCTACAGAGTGAGTTCCAGGACAGCCAGGGCTACACAGAGAAACCCAGTCTTGAAAAACCAAAAAAAA

AAGAAAGAAAAAAAGAAAGAAAGAAAGAAAGAAAGAAAGAAAGAAAGAAAGAAAGAAATGAAACAATCCCAAATGATTGCTTGAGGTGGACCAGCAGAGA

GACGTCTCTGATGTGCTGCTGTCTAGGATGTGGCTATGCAGTGTCTGTGTGCACAATAGGACTGTGGAGAAGGCATCCTGCAGGAGTTGGACTATAGGAC

TCCCAACATTACCCAGTGCTGAAGTTTGCAGATAACCTTGCTTTTTATTTACCCACCAAGTAGCTGTCAAGTCCTCTGAATATCAAATATTATACTAAAG

ATAGCGCTGTGATTTCCAAATCCTGCATAAATCAAGATCGCTGCTGTTCTAACTTTGCGATTTGGGAAGTTTACTGAATTCCCATTGACTGCACTAATTA

TGAATCTTAAGTAACTTTCCCTTTGGACCAAAGGAGTGAGTCAGCTTTGGCACCATGGTTTAAAGTTGTATGTAGTATGAATTCCTCTTCATTTCAGCTC

TTTTGACTTTCATTCTATAAAAACAGTGACTTAAGAGATAGCAGTTACTGCTAGGCATGCTGGCGCCTGCTGGCCGTCTCAGCACTTGGGAGTGTGAATC

AGGTTGGTCTAGCTCACTCTCAGCACCACCAGCAGCCTGTGCTGCATGAAGCCTGTGCTAAACAGCCCGAGAGGAAACGAAGATCAATTACTAACCAGAA

ATACAACTTCAATTTGGTAGTGTGCATGCTACTTTCAGAAATATTCTAGTATTTCAGTGTTTCTATATTTATACCAAGGGATTTGCATGCACCTGGCATA

GTTTGCCCCTTTAACATACTATTACGTAGAAGTATCAAATTTCTGAGTTCTTATCATTTGTTTATTAGCAGAGTAAAACCATTTCTAGTTTTCCACTTTG

GTAGCCTTTATAGCCAGCTTTTTGCCACATTCTAAAATATTTAGCTGCCTTTTGTTGTTTCGGTTTTGTTTCATTTTAGTGCTGGGAATCAAATCCAGGG

CCTTCTGCATACTAGGCAAGTCCCCTACCACTGAGCTACATCCCTGGCCCGAGCTGAAGCTGTTCATACGTGTCAGTGGCCGCTCATTAGGGACCAGCAA

GGGACCAGCATGGGAATCAGGGAAGGCTGGCTGTTTAGTATGTGAACTGGCATTGCGTCTGCTATCAGGGGGGGACTACATTGAAACAGAGCTTTGCCAA

AATTTCAAACACTTGAACATTTGTGAAGAAAATGGAGTTGAATTTCAGGTCTTGCCCTTGCCATTAAAAACATCAGACAGGAGACTTGGTTTACTGGGTA

CAGAGGTACTTGACTGTTGAGTACCTGCGGCACCTGACCCTGTCACTGTGCCAACCAAAGCAGCTGCAGTGTACCAGCTATTGACATGAACATGTTTACA

AAGTTGAGTTTTGTCTTCATAAAAGAATGATTTTTAAAAAACTTTTTACATAGTTATGACTCAATGTGTTTAAAGCATAACAAGTTAGCTTAAATATATG

GTCTTTACTTGAATTTTAATTCTTACAGATAGCAAATTTTGACTGTTTACAGGAATGCTTGAAATGAGTCAAGAGATCTCTAATTCTCTCTGAAGCAAAA

CTGATACAGGCTTAGTGTTCGAGCCTGTGTATTTGTGGCATTGGATAGGCAGTAACTCAAAACTACGTTTCGCTTACATCTTGTTCTATAAAGTAGTACT

TTTGCGTGGATAAGTATTTTTAACTGATATTAAGAAATCATATTTTTGCATTTCAGTCAAACTAGTAAGAACATACGTAAAAGTACAAATGAGATGTAAA

TCTGAAATTCATGTTTCATATGATCAAGCTGTATTTTTAAATTCAAATTTAAAATACAATAGAGATTCAGAAAGGTCCATATTTTTCTAATGACTTCATG

CTATATTATTTTCTTGAGTTACGTAAAGCAAGGAATTGTATTTGTATTAAGGAGCTAAGGAAGCTGTTAGTTTATTATATTTGTACATGATTACAGACAA

GCCTATGCCCATTTAAAAGAAAAGATGGATACTATTTAAGGTGATATTTAATATGTTTTTCTATAAACAAGTTTGAAATATAGTTTGCCTTAGTTGTCTT

ATCAGTAGCATAGCCTTCTATTTATTTCTCATTATGTGAACCTGGACTATGACCAGTGACTCTTGTCTCTGTATTTTGGATGGCCTAACCTACATTACTA

TGTGTGCATTTTACAACTTTTTTTTTTCAGAAACCATAATTACTTTATTAATAAACAGATAAAGATATTGTCTTGTTTTTTAATGGTTTTGTTGCCATTA

TATTTGTCAAATGAGAAAATAATTGTCATTTTGATCCGCA
Translation
MAPWTLWRCCQRVVGWVPVLFITFVVVWSYYAYVVELCVS - UNI14567 - - UNI26423 - STISRTGEKG - UNI14567 - GKTVVYLVA

FHLFFVMFVWSYWMTIFTSPASPSKE - UNI14567 - - UNI16633 - FYLSNSEKERYEKEFSQERQQDILRRAARDLPIYTTSASKA - UNI

9228 - AIRYCEKCQLIKPDRAHHCSACDR RCVLKMDHHCPW - UNI19931 - - UNI33114 - WVNNCVGFTNYKFFMLFLLYSLLYCLFVA

ATVLEYFIKFWT - UNI13205 - - UNI33114 - NEPTVLNFPSAKFHVLFLFFVSAMFFVSVLSLFSYHCWLVGKNRTTIE - UNI20515 -

 ESFRAPMFSYGIDGNGFSLGCSKNWRQVFGDEKKYWLVPIFSS SLGDGCSFPARLVGMDPEQASVANQSDYVRS - UNI20532 - SIGSNQPFPI

KPLSESKNRLLDSESQWLENGAEEGVTKSG GTNNHVTVEIEN 
Transcript ENSMUST00000022541
Sequence
GGGGAAGCTGGCGACAGGGCCGCTGGGGTCTTGTGGTCCTACAGAATCGTGGGCAGCGGGACCCGGCAGTCAGCAGAGGAACATGGCGCCCTGGACACTC

TGGCGCTGCTGCCAACGCGTGGTGGGCTGGGTTCCGGTGCTCTTCATCACCTTTGTGGTCGTCTGGTCCTACTACGCGTACGTGGTGGAGCTGTGCGTGA

 - UNI14567 - - UNI26423 - GTACTATTTCCAGAACAGGAGAGAAAG - UNI14567 - GAAAGACCGTTGTTTACCTTGTGGCTTTCCAT

CTGTTCTTTGTTATGTTTGTATGGTCTTATTGGATGACAATATTCACGTCTCCTGCTAGCCCTTCCAAAGAG - UNI14567 - - UNI16633 - T

TCTACTTGTCAAACTCTGAGAAGGAGCGTTATGAGAAGGAGTTCAGCCAAGAAAGACAGCAAGACATTTTGAGAAGAGCGGCAAGAGACCTGCCTATCTA

CACCACATCAGCTTCAAAGG - UNI9228 - CTATCCGATATTGTGAAAAATGTCAGTTGATTAAACCTGACCGAGCCCATCACTGCTCAGCATGTGA

CAG ATGTGTTCTTAAGATGGATCATCACTGTCCATG - UNI19931 - - UNI33114 - GGTGAATAACTGTGTGGGATTTACTAATTACAAATT

CTTCATGCTGTTTTTGTTGTATTCTCTACTATATTGCCTTTTTGTGGCTGCAACAGTTTTAGAGTATTTTATAAAATTTTGGACG - UNI33114 - C

TTTGCCGCAGGAAATCTACAGAGAATTGCCCAAAG - UNI13205 - - UNI33114 - AATGAACCAACAGTTTTAAATTTCCCCAGCGCAAAGTT

CCACGTACTGTTCCTTTTTTTTGTGTCTGCAATGTTCTTCGTCAGTGTGCTCTCACTATTTAGCTACCATTGCTGGCTGGTTGGAAAAAATAGAACGACA

ATAG - UNI20515 - AATCATTTCGTGCACCTATGTTTTCTTATGGAATAGATGGAAATGGTTTCTCTCTTGGATGCAGTAAAAATTGGAGACAAGT

CTTTGGTGATGAAAAGAAATATTGGCTAGTTCCAATATTCTCAAG TTTGGGTGATGGTTGCAGTTTTCCAGCTCGCCTTGTGGGGATGGATCCAGAACA

AGCTTCTGTTGCAAACCAGAGTGACTACGTCAGAAG - UNI20532 - TATTGGCTCAAATCAACCTTTTCCTATCAAACCACTTAGTGAATCAAAAA

ACCGCTTATTGGACAGTGAATCTCAGTGGCTAGAGAATGGAGCTGAAGAAGGAGTCACCAAATCAG GGACAAATAACCATGTTACAGTGGAAATAGAAA

ATTGAGTACTACTTGTTCATAACTAACCATTTGATGAGTGCAAG GTATATAAAAACACATTTTGGACTATTTTCAATTTTATTTGCAAGAAAATGATGG

ATGGAATGAAATACTTGAAGTGTAACAGAAGATATATTTTTAAAAGGAAATGTTTGTACAGTTTGATGGATCCACAGAAGCACTGCAGAGCGGAAAGATG

CCTTAATTTTTAGTGTCCATTTGTGTGACATTGCCTCACAGCTCAAAAGTGACTTAATTTTCCTTTGGAAATAACACCTGTTTTACAATGCTATCGTCAC

GTGTTAACATGCCATATGTATTTTAAACATCTGAGTTACAACATTAGAGCTATTTCTTAGTATCCACATAAATTTTCACCCCAAAAACACAAACTAAAAA

GTTGTCTGTGGTGAAGTATACCTAGGGAAAACGGGGGCTAAAAATGATGCCCAAATCACTGATTCTTGTGCTGTATAAGGGAAAGAAATACCGCTTTTTT

TATTAGATGTTTACTAATTTATAATTACTGTTTTATACTTTTCAACATTTTAATAAAGATTTTTTAATTATTGGCTATAAAATAACACTCAAAGAAGGAT

TCAGGTACCTAAATATAATCATTTAGAACATTGAAGATATTAATATAATTCAGTGAAGGTTTAGTTAGAAGCATTAATACTTCTAATTAGTACTTTTAAA

AGCCAAGTGGCACATGCCTATAATCCCAGCATTCAGAAGGCTGAGGTAATATTCTGTGATTTTGAGTCTAGCATTGGTTGCATAGAGACCGTATCTAAAA

CACAGAATAATACAGCCATGTGGTGTAGTGTGAGCCCAAGGCTCAAAGGAAACATGGTAGGAAACAACTACACGTTGGTATTCTCTGCTCTTTAATTACT

AGTTGTTGAGTGTTCAAGGGAAGTTTTTATGGGCAGGGAAGCACAGAGGTTCACGTGCTATCCAAAGACCTAACACATATATGAATAGGTGGGAGTGACT

AGAAAAAAAGAGAATGAAAGAAGGAGTATTATAAACAAGTAAACAAATTTTCATCCCTAAAAGTATATAGACTACAACATGCTATTAAATAGGATTTCAT

TTAGGCAATGTCTAAAAATTACTGTGGTCGTTTACAGGAATCCTGTAGCCGAGTCAACAGCAACTCAAATGCAGTTCAGATAAGGATGAAATATGTAAAA

CAAAACCACGACGTCCCAGGCTTGGGCTGGAGAAATGTCTCAGTAGATAAAGGCCCTTGCCCTCAGACCTACAACCTGACATCAGCCACATTCTGGAAGA

AGATACCTAACTCCCACACATTGTCCTCTGGCATTTACATGTGCACTATGGTGCACATAGACTCTTTAAAAGATAGTACGTTTTTAGCGTCTAGTGGCTT

TAATAGAAATGGCTGTATTGAGGAGATTAGTCCACTGGTCTGTCAAAAGGCAATGTAGAGATGCTATTTTTGGTTTATACCGTTTATCAAAGAAACAAAC

GCCAGGCGTGGTGGCGCACGCCTTTAATCCCAGCACTTGGGAGGCAGAGGCAGGTGGATTTCTGAGTTCGAGGCCGGCCTGGTCTACAGAGTGAGTTCCA

GGACAGCCAGGGCTACACAGAGAAACCCAGTCTTGAAAAACCAAAAAAAAAAGAAAGAAAAAAAGAAAGAAAGAAAGAAAGAAAGAAAGAAAGAAAGAAA

GAAAGAAATGAAACAATCCCAAATGATTGCTTGAGGTGGACCAGCAGAGAGACGTCTCTGATGTGCTGCTGTCTAGGATGTGGCTATGCAGTGTCTGTGT

GCACAATAGGACTGTGGAGAAGGCATCCTGCAGGAGTTGGACTATAGGACTCCCAACATTACCCAGTGCTGAAGTTTGCAGATAACCTTGCTTTTTATTT

ACCCACCAAGTAGCTGTCAAGTCCTCTGAATATCAAATATTATACTAAAGATAGCGCTGTGATTTCCAAATCCTGCATAAATCAAGATCGCTGCTGTTCT

AACTTTGCGATTTGGGAAGTTTACTGAATTCCCATTGACTGCACTAATTATGAATCTTAAGTAACTTTCCCTTTGGACCAAAGGAGTGAGTCAGCTTTGG

CACCATGGTTTAAAGTTGTATGTAGTATGAATTCCTCTTCATTTCAGCTCTTTTGACTTTCATTCTATAAAAACAGTGACTTAAGAGATAGCAGTTACTG

CTAGGCATGCTGGCGCCTGCTGGCCGTCTCAGCACTTGGGAGTGTGAATCAGGTTGGTCTAGCTCACTCTCAGCACCACCAGCAGCCTGTGCTGCATGAA

GCCTGTGCTAAACAGCCCGAGAGGAAACGAAGATCAATTACTAACCAGAAATACAACTTCAATTTGGTAGTGTGCATGCTACTTTCAGAAATATTCTAGT

ATTTCAGTGTTTCTATATTTATACCAAGGGATTTGCATGCACCTGGCATAGTTTGCCCCTTTAACATACTATTACGTAGAAGTATCAAATTTCTGAGTTC

TTATCATTTGTTTATTAGCAGAGTAAAACCATTTCTAGTTTTCCACTTTGGTAGCCTTTATAGCCAGCTTTTTGCCACATTCTAAAATATTTAGCTGCCT

TTTGTTGTTTCGGTTTTGTTTCATTTTAGTGCTGGGAATCAAATCCAGGGCCTTCTGCATACTAGGCAAGTCCCCTACCACTGAGCTACATCCCTGGCCC

GAGCTGAAGCTGTTCATACGTGTCAGTGGCCGCTCATTAGGGACCAGCAAGGGACCAGCATGGGAATCAGGGAAGGCTGGCTGTTTAGTATGTGAACTGG

CATTGCGTCTGCTATCAGGGGGGGACTACATTGAAACAGAGCTTTGCCAAAATTTCAAACACTTGAACATTTGTGAAGAAAATGGAGTTGAATTTCAGGT

CTTGCCCTTGCCATTAAAAACATCAGACAGGAGACTTGGTTTACTGGGTACAGAGGTACTTGACTGTTGAGTACCTGCGGCACCTGACCCTGTCACTGTG

CCAACCAAAGCAGCTGCAGTGTACCAGCTATTGACATGAACATGTTTACAAAGTTGAGTTTTGTCTTCATAAAAGAATGATTTTTAAAAAACTTTTTACA

TAGTTATGACTCAATGTGTTTAAAGCATAACAAGTTAGCTTAAATATATGGTCTTTACTTGAATTTTAATTCTTACAGATAGCAAATTTTGACTGTTTAC

AGGAATGCTTGAAATGAGTCAAGAGATCTCTAATTCTCTCTGAAGCAAAACTGATACAGGCTTAGTGTTCGAGCCTGTGTATTTGTGGCATTGGATAGGC

AGTAACTCAAAACTACGTTTCGCTTACATCTTGTTCTATAAAGTAGTACTTTTGCGTGGATAAGTATTTTTAACTGATATTAAGAAATCATATTTTTGCA

TTTCAGTCAAACTAGTAAGAACATACGTAAAAGTACAAATGAGATGTAAATCTGAAATTCATGTTTCATATGATCAAGCTGTATTTTTAAATTCAAATTT

AAAATACAATAGAGATTCAGAAAGGTCCATATTTTTCTAATGACTTCATGCTATATTATTTTCTTGAGTTACGTAAAGCAAGGAATTGTATTTGTATTAA

GGAGCTAAGGAAGCTGTTAGTTTATTATATTTGTACATGATTACAGACAAGCCTATGCCCATTTAAAAGAAAAGATGGATACTATTTAAGGTGATATTTA

ATATGTTTTTCTATAAACAAGTTTGAAATATAGTTTGCCTTAGTTGTCTTATCAGTAGCATAGCCTTCTATTTATTTCTCATTATGTGAACCTGGACTAT

GACCAGTGACTCTTGTCTCTGTATTTTGGATGGCCTAACCTACATTACTATGTGTGCATTTTACAACTTTTTTTTTTCAGAAACCATAATTACTTTATTA

ATAAACAGATAAAGATATTGTCTTGTTTTTTAATGGTTTTGTTGCCATTATATTTGTCAAATGAGAAAATAATTGTCATTTTGATCCGCA
Translation
MAPWTLWRCCQRVVGWVPVLFITFVVVWSYYAYVVELCVS - UNI14567 - - UNI26423 - STISRTGEKG - UNI14567 - GKTVVYLVA

FHLFFVMFVWSYWMTIFTSPASPSKE - UNI14567 - - UNI16633 - FYLSNSEKERYEKEFSQERQQDILRRAARDLPIYTTSASKA - UNI

9228 - AIRYCEKCQLIKPDRAHHCSACDR RCVLKMDHHCPW - UNI19931 - - UNI33114 - WVNNCVGFTNYKFFMLFLLYSLLYCLFVA

ATVLEYFIKFWT - UNI33114 - LCRRKSTENCPK - UNI13205 - - UNI33114 - NEPTVLNFPSAKFHVLFLFFVSAMFFVSVLSLFSY

HCWLVGKNRTTIE - UNI20515 - ESFRAPMFSYGIDGNGFSLGCSKNWRQVFGDEKKYWLVPIFSS SLGDGCSFPARLVGMDPEQASVANQSDYV

RS - UNI20532 - SIGSNQPFPIKPLSESKNRLLDSESQWLENGAEEGVTKSG GTNNHVTVEIEN 

For any suggestions or comments, please send an email to unitrap@crg.es