Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000021975 (Ints9)
Chromosomal location
Chr 14: 65568882 - 65658663 (+)
Description
integrator complex subunit 9 Gene [Source:MGI Symbol;Acc:MGI:1098533]
RefSeq_dna
NM_153414 
RefSeq_peptide
NP_700463.2 
UniGene
Mm.403725 
MGI
MGI:1098533 
Uniprot/SWISSPROT
Q8K114 
Human Ortholog
ENSG00000104299 (INTS9)
Omim not available
UniTrap UNI4916
Vector Insertion
Chr 14: 65569205 - 65598349
Public Clones (sanger) AP0559 (sanger) XB269 (baygenomics) IST11469E8 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI19328
Vector Insertion
Chr 14: 65598359 - 65598958
Public Clones not available
Private Clones OST394998 (lexicon) OST369728 (lexicon) OST331903 (lexicon) OST329343 (lexicon)
OST240331 (lexicon) OST236846 (lexicon) OST235599 (lexicon) OST223372 (lexicon)
OST213418 (lexicon) OST203817 (lexicon) OST117027 (lexicon) OST111168 (lexicon)
OST63504 (lexicon) OST53884 (lexicon) OST47518 (lexicon) OST43656 (lexicon)
OST38025 (lexicon) OST34794 (lexicon) OST15505 (lexicon)
Severity of mutation (?) Insertion after 1% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI24497
Vector Insertion
Chr 14: 65609432 - 65611810
Public Clones not available
Private Clones OST218009 (lexicon)
Severity of mutation (?) Insertion after 15% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI4430
Vector Insertion
Chr 14: 65626963 - 65635366
Public Clones AC0735 (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 43% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000067704
Sequence
CTGAGACTG - UNI19328 - TATTGCCTGTCAGGGCACCCAACTTTACCATGCAACGTACTCAAATTCAAATCCACTACTATTATGTTGGACTGTGG

ACTGGACATGACTTCCACCCTCAATTTCCTCCCTTTGCCTCTTGTTCAAAG CCCCAGGCTATCTAATCTTCCCGGATGGTCTCTAAAAGACGGAAATGC

TTTTTTGGACAAG GAGCTAAAAGAGTGCTCCGGTCATGTATTTGTGGATTCTGTGCCTGAATTCTGCTTACCAGAG - UNI24497 - ACCGAGCTA

ATAGACCTGTCTACAGTCGATGTGATCCTCATCTCTAACTACCACTGCATGATGGCGCTGCCCTACATCACCGAGCACACAGGATTCACAGGCACAGTGT

ATGCCACAGAACCCACCATGCAGATCGGCAG GCTTCTCATGGAAGAGCTGGTGAATTTCATCGAAAGAGTGCCAAAGGCCCAGTCTGCCTCCTTGTGGA

AGAATAAGGATATACAGCG GCTGCTGCCTTCTCCCCTCAAGGATGCAGTGGAAGTGTCAACCTGGAGAAGATGCTACACGATGCAGGAGGTGAACTCGG

CCCTCAGTAAAATCCAGCTGGTGGGATATTCCCAGAAAATC GAGCTGTTTGGTGCTGTCCAGGTGACCCCTCTGAGCTCTGGCTATGCCCTTGGAAGCT

CCAACTGGATTATCCAGTCACATTATGAGAAAGTATCTTACGTCTCTGGATCCTCCTTGCTTACCACACACCCTCAG - UNI4430 - CCCATGGACC

AAGCTTCTCTCAAAAACAGTGACGTTCTGATTCTCACAGGGCTGACACAGATCCCTACTGCAAACCCGGACGGCATGGTGGGCGAGTTCTGCAGCAACCT

CG CTCTGACAGTTCGGAATGGAGGAAACGTGTTGGTCCCTTGCTATCCTTCAGGCGTGATCTATGACCTCCTGGAGTGCTTATATCAATACATTGACTC

CGCTGGCCTCTCCAACATCCCTTTCTACTTCATCTCCCCCGTTGCCAACAGTTCACTCGAGTTTTCCCAGATTTTTGCTGAGTG GCTTTGTCACAACAA

ACAGAGTAAAGTTTACCTCCCAGAACCACCTTTCCCACATGCAGAG CTCATTCAGACGAATAAGCTGAAGCACTACCGCAGCATCCACGGTGACTTCAG

CAATGACTTCAGACAGCCGTGTGTGCTGTTCACCGGACATCCTTCCCTCCGCTTTGGGGACGTCGTCCACTTCATGGAGCTCTGGGGGAAGTCCAGCCTC

AACACCATCATATTCACAG AACCCGATTTCTCCTACCTGGAGGCCTTGGCTCCTTACCAGCCGCTGGCCATGAAGTGCATCTACTGCCCAATTGACACT

CGACTGAATTTCATCCAGGTGTCAAAGCTGCTTAAAGAAGTACAG CCCCTGCACGTGGTCTGTCCTGAGCAGTACACCCAGCCACCGCCAGCCCAGGCC

CACAGGATGGACCTCATGATCGACTGCCAGCCACCAGCCATGTCCTATCGACGGGCTGAGGTCCTTGCCCTGCCCTTCAAACGACGCTATGAGAAAATTG

AAATCATGCCAGAGGTGAGCTGCTGCCCTTTCACCCTTAAAAGCCTGCTTTCCACCAGAGTGCACTCAGGACACTGTCAGTCTCTCAAAACTGAAGGAAG

GAAAGAGCACAGACCCCCAGGCAAGTTATGTTACGTTCCTTATGTAGCCTTCACTGGTATGGCCCTGCAGGTGACATCCTGAGTCTCCACCATGGAGGAT

GCTAGTGCCCTCTGAGGGTTTGTCATCCTTCCTGGAATTATGTATGAAAAAGGAGAAGTGTAAACTTAGTTGTATCGATGCCATGTAAAGGTTCTATCTA

AAAGTCCAAATGGCTTACATTCTAAGTGCTAGCTTGAGTTCTATCACAAGGAAATGTAAAAAGCGCAAAGCACATCGTACAAATGATGCCACAGTGAAGT

AGTGCCGTGCATAGGTGACTCTGCTAGGGAAGAGGAGGAGGAAGAGGGGTGACTGTAGAGCAATGGGGGGCTGCAGCCCAGGGGCCTCCAGCATATGGGT

TCTTCAGTGTCTATCAGAGCTTCGAACACCTTTGACTTGACTAAATGGCTATCCGTGGAAAAGTTCTCAACTCCAGAAAACAGATGGCTCCGCTGTGCCA

GGTTCTCTAGGTTTCTCTTACAGATGCTCTGCTCCCTTCTCTGTCCACCGCCGTCCTTTCAGCTTCTGAGTGCTTTCTCCAGGTGCTGCTGCATGTGGGG

GCCAAGGCTGTCATGGAAGACAGTGTAGGGCAGAATCAGTGTCACTTGACCACAGCCCTGGAAAGTACACGTGGAAGATGAAATGGTTAAAATCTGCTGC

AGTTAGAGGAAGCCCTCTCCCCAGACTGCAGCCTCTTTAATCTAGACTTCCAGGATGGAGGATTTACAGAGCTGTTAGTCCTTAGGCCTGTTCTCATAGA

AGATGGACCTCCCGACTCTACTTCATGAGGCGTGGGGGAGTGTTGACCTAAGCTGCATGGTGTGGGGCTCTGAACTGGCTCCCATGGAACCAGAGGTGTT

GCTGCCCAGGGAATCTCACCAAGTTGGTCCCCAGGATGCCATCCTGAAGTGTGCAGAGAACAGTCACTTACGGGGCAGACTGTGAACAGGGCCGAGGTGA

AGGATGTGACCTGGCACAGTCAGGTGTTGGGGAACTGCCACAGTGTGGAACTCCTCACCCTCCCTCCTCCCACGCTTGAACTTCAGGAAGCAGACCTCAT

AACTTGTGTTGTTGATGTGTAAAGGCTATAAGCTGCTTCTCCTACCCAACTGGCATTGACTAGCAGTGCTTGTAGAATGGCATCTTGCACATAGGTTTGT

TTTTAAATGAAGGCAGCCTGGCTTGGGGGAAAGCTGTACATCTGAGGACGGCACATAGGCAGGCCTGAGCACCAGGACCCCAGAGCTCCGAGCTCACTGC

AGTGTGTGCACAATGGCTGCTCAGGTCACAGTAGGAGACACTTGTCCTGCCATTGACAGACACCAGATTGCTAGGGATC
Translation
LRL - UNI19328 - YCLSGHPTLPCNVLKFKSTTIMLDCGLDMTSTLNFLPLPLVQS SPRLSNLPGWSLKDGNAFLDK ELKECSGHVFVDSVPEF

CLPE - UNI24497 - TELIDLSTVDVILISNYHCMMALPYITEHTGFTGTVYATEPTMQIGR RLLMEELVNFIERVPKAQSASLWKNKDIQR RLL

PSPLKDAVEVSTWRRCYTMQEVNSALSKIQLVGYSQKI ELFGAVQVTPLSSGYALGSSNWIIQSHYEKVSYVSGSSLLTTHPQ - UNI4430 - PMD

QASLKNSDVLILTGLTQIPTANPDGMVGEFCSNLA ALTVRNGGNVLVPCYPSGVIYDLLECLYQYIDSAGLSNIPFYFISPVANSSLEFSQIFAEW WL

CHNKQSKVYLPEPPFPHAE LIQTNKLKHYRSIHGDFSNDFRQPCVLFTGHPSLRFGDVVHFMELWGKSSLNTIIFTE EPDFSYLEALAPYQPLAMKCI

YCPIDTRLNFIQVSKLLKEVQ PLHVVCPEQYTQPPPAQAHRMDLMIDCQPPAMSYRRAEVLALPFKRRYEKIEIMPEVSCCPFTLKSLLSTRVHSGHCQ

SLKTEGRKEHRPPGKLCYVPYVAFTGMALQVTS
Transcript ENSMUST00000043914
Sequence
AGAATACCATGGATGCTAGACCCAGATGAGGGACATGATATCATGCTGGGATGGAAAGGAAGGATGAATTGGCGGCGGCGATGAATTTGAGCGGACGGAA

GGAGGTGATTAGAGAGAAAAGGGAGGAAAAGGAAAGACGCCCACAGTGCCCATGATACCTGCAGTAAAACTACATTTCCCGTGAGGCTCTGGAAAATGCT

TAAGGAGTGAAGACTCCAAGTCCCGCGATGCTCTGGGCTATAGAGATTAAACCGGAAGATCCTTCCCTGTCTTTAGAAGTGAAGAGACTGGTACTGAACA

ACCAAAAGTCCGATATGAAACTG - UNI4916 - - UNI19328 - TATTGCCTGTCAGGGCACCCAACTTTACCATGCAACGTACTCAAATTCAAA

TCCACTACTATTATGTTGGACTGTGGACTGGACATGACTTCCACCCTCAATTTCCTCCCTTTGCCTCTTGTTCAAAG CCCCAGGCTATCTAATCTTCCC

GGATGGTCTCTAAAAGACGGAAATGCTTTTTTGGACAAG GAGCTAAAAGAGTGCTCCGGTCATGTATTTGTGGATTCTGTGCCTGAATTCTGCTTACCA

GAG - UNI24497 - ACCGAGCTAATAGACCTGTCTACAGTCGATGTGATCCTCATCTCTAACTACCACTGCATGATGGCGCTGCCCTACATCACCGA

GCACACAGGATTCACAGGCACAGTGTATGCCACAGAACCCACCATGCAGATCGGCAG GCTTCTCATGGAAGAGCTGGTGAATTTCATCGAAAGAGTGCC

AAAGGCCCAGTCTGCCTCCTTGTGGAAGAATAAGGATATACAGCG GCTGCTGCCTTCTCCCCTCAAGGATGCAGTGGAAGTGTCAACCTGGAGAAGATG

CTACACGATGCAGGAGGTGAACTCGGCCCTCAGTAAAATCCAGCTGGTGGGATATTCCCAGAAAATC GAGCTGTTTGGTGCTGTCCAGGTGACCCCTCT

GAGCTCTGGCTATGCCCTTGGAAGCTCCAACTGGATTATCCAGTCACATTATGAGAAAGTATCTTACGTCTCTGGATCCTCCTTGCTTACCACACACCCT

CAG - UNI4430 - CCCATGGACCAAGCTTCTCTCAAAAACAGTGACGTTCTGATTCTCACAGGGCTGACACAGATCCCTACTGCAAACCCGGACGGC

ATGGTGGGCGAGTTCTGCAGCAACCTCG CTCTGACAGTTCGGAATGGAGGAAACGTGTTGGTCCCTTGCTATCCTTCAGGCGTGATCTATGACCTCCTG

GAGTGCTTATATCAATACATTGACTCCGCTGGCCTCTCCAACATCCCTTTCTACTTCATCTCCCCCGTTGCCAACAGTTCACTCGAGTTTTCCCAGATTT

TTGCTGAGTG GCTTTGTCACAACAAACAGAGTAAAGTTTACCTCCCAGAACCACCTTTCCCACATGCAGAG CTCATTCAGACGAATAAGCTGAAGCAC

TACCGCAGCATCCACGGTGACTTCAGCAATGACTTCAGACAGCCGTGTGTGCTGTTCACCGGACATCCTTCCCTCCGCTTTGGGGACGTCGTCCACTTCA

TGGAGCTCTGGGGGAAGTCCAGCCTCAACACCATCATATTCACAG AACCCGATTTCTCCTACCTGGAGGCCTTGGCTCCTTACCAGCCGCTGGCCATGA

AGTGCATCTACTGCCCAATTGACACTCGACTGAATTTCATCCAGGTGTCAAAGCTGCTTAAAGAAGTACAG CCCCTGCACGTGGTCTGTCCTGAGCAGT

ACACCCAGCCACCGCCAGCCCAGGCCCACAGGATGGACCTCATGATCGACTGCCAGCCACCAGCCATGTCCTATCGACGGGCTGAGGTCCTTGCCCTGCC

CTTCAAACGACGCTATGAGAAAATTGAAATCATGCCAGAG CTGGCAGACTCCCTGGTGCCCATGGAAATCAAGCCTGGCATCTCCTTGGCGACTGTCTC

AGCTGTGCTGCATACGAAGGATAACAAACATGTGCTTCAG CCCCCTCCCAAGCCCACCCAGCCCACCAGCAGTAAGAAGAGGAAGCGGGTGAACGAGGA

CATTCCTGACTGCAAAGTACTGAAGCCTCTGCTGAGTGGCTCCATCCCCGTAGAGCAGTTTGTGCAGACCCTGGAGAAG CATGGCTTCAGTGACATTAA

GGTGGAAGACACAGCCAAGGGACATATTGTCCTGCTGCAGGAAGCCGAGACACTCATCCAGATTGAAGAAGACTCCACTCACATCATCTGTGACAATGAC

GAGACACTGAGGGTCCGACTGCGGGACCTTGTCCTCAGGTTCCTGCAGAAGTTCTGAGTGGCATCCGTGACATCCTAGGCCCTTCACCCAGAGACAGTCT

GGTGGTGTCCTATGACTTCCGGAGAGGAGAGGTGTCTCCAGCTAGGATCTGCCAGTGTGACTTCCTCGTACTGCTGACCCCAAGAACGTTTAGAGGCCTG

TTCTTTTCAGTTCTGGGCTCCTGAGCAGCTATGGGTGACAACATGACAGACATCCTTTCCTAAGGGAAATGAAAAAAAAAAAATGCCTGGCCTGTGTTTT

TGGGGCTCACAGGGGGTGACTCTCGGACTTACCCTCCTACAGTGCTACACCGTATAAAGGTCAGCCCCCAAATTAGAAGGCAAACCTATCTCGCTGTTCT

GTGGCCCGTTTTGCTAAAAATAAACATTATTTTT
Translation
MLWAIEIKPEDPSLSLEVKRLVLNNQKSDMKL - UNI4916 - - UNI19328 - YCLSGHPTLPCNVLKFKSTTIMLDCGLDMTSTLNFLPLPLVQ

S SPRLSNLPGWSLKDGNAFLDK ELKECSGHVFVDSVPEFCLPE - UNI24497 - TELIDLSTVDVILISNYHCMMALPYITEHTGFTGTVYATEP

TMQIGR RLLMEELVNFIERVPKAQSASLWKNKDIQR RLLPSPLKDAVEVSTWRRCYTMQEVNSALSKIQLVGYSQKI ELFGAVQVTPLSSGYALGSS

NWIIQSHYEKVSYVSGSSLLTTHPQ - UNI4430 - PMDQASLKNSDVLILTGLTQIPTANPDGMVGEFCSNLA ALTVRNGGNVLVPCYPSGVIYDL

LECLYQYIDSAGLSNIPFYFISPVANSSLEFSQIFAEW WLCHNKQSKVYLPEPPFPHAE LIQTNKLKHYRSIHGDFSNDFRQPCVLFTGHPSLRFGDV

VHFMELWGKSSLNTIIFTE EPDFSYLEALAPYQPLAMKCIYCPIDTRLNFIQVSKLLKEVQ PLHVVCPEQYTQPPPAQAHRMDLMIDCQPPAMSYRRA

EVLALPFKRRYEKIEIMPE LADSLVPMEIKPGISLATVSAVLHTKDNKHVLQ PPPKPTQPTSSKKRKRVNEDIPDCKVLKPLLSGSIPVEQFVQTLEK

 HGFSDIKVEDTAKGHIVLLQEAETLIQIEEDSTHIICDNDETLRVRLRDLVLRFLQKF

For any suggestions or comments, please send an email to unitrap@crg.es