Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000021978 (Extl3)
Chromosomal location
Chr 14: 65670901 - 65699312 (-)
Description
exostoses (multiple)-like 3 Gene [Source:MGI Symbol;Acc:MGI:1860765]
RefSeq_dna
NM_018788 
RefSeq_peptide
NP_061258.2 
UniGene
Mm.472977 Mm.103748 
MGI
MGI:1860765 
Uniprot/SWISSPROT
Q9WVL6 
Uniprot/SPTREMBL
Q3UUW7 Q5DU26 Q6P1H4 
Human Ortholog
ENSG00000012232 (EXTL3)
Omim not available
UniTrap UNI9503
Vector Insertion
Chr 14: 65685648 - 65694420
Public Clones RST338 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 78% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI21389
Vector Insertion
Chr 14: 65677967 - 65685519
Public Clones not available
Private Clones OST332445 (lexicon)
Severity of mutation (?) Insertion after 83% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000111165
Sequence
CTTGTGCAGGGAGCACACTGATCCTTCCAGAAACTTGTGTGTGAAAAGAGGTTGCGTTTTGTCAGACAGACTCATGGTTATGGCGAGCGATCCGACGTGA

TCAGAGTGGGCAAGAGGCACAGCGAACTCATGACAGGCTATACCATGTTGCGGAATGGGGGAGTGGGGAACGGTGGTCAGACCTGTATGCTGCGCTGGTC

CAATCGCATCCGGCTGACATGGCTGAGTTTCACGCTGTTCATCATCCTCGTCTTCTTCCCCCTCATTGCTCACTATTACCTCACCACTCTGGACGAGGCA

GACGAGGCTGGCAAGCGCATCTTCGGCCCTCGGGCTGGCAGTGAGCTCTGTGAGGTAAAGCACGTCCTCGATCTCTGTCGGATTCGTGAGTCTGTGAGCG

AAGAGCTTCTACAGCTCGAAGCCAAGCGGCAGGAGCTGAACAGCGAGATTGCCAAGCTGAACCTCAAGATTGAAGCCTGTAAGAAGAGCATAGAGAATGC

CAAGCAGGACCTGCTGCAGCTCAAGAATGTCATTAGCCAGACAGAGCACTCCTACAAGGAGCTGATGGCCCAGAACCAGCCCAAACTGTCCCTGCCCATC

CGACTGCTCCCCGAGAAGGACGATGCCGGCCTTCCACCCCCCAAGGTCACTCGGGGTTGCCGCCTTCACAACTGCTTTGATTACTCTCGTTGTCCTCTGA

CGTCTGGCTTTCCCGTCTACGTCTATGACAGTGACCAGTTTGCCTTTGGGAGCTACCTGGACCCTTTGGTCAAGCAGGCTTTTCAGGCTACAGTGAGAGC

CAACGTTTATGTTACAGAAAATGCGGCCATCGCCTGCCTGTATGTGGTGTTAGTGGGAGAAATGCAAGAGCCCACTGTGCTGCGGCCTGCCGACCTTGAA

AAGCAGCTGTTTTCTCTGCCACACTGGAGGACAGATGGGCACAACCACGTCATTATCAACCTGTCCCGGAAGTCAGACACACAGAATCTACTGTACAACG

TCAGTACAGGCCGGGCCATGGTGGCCCAGTCCACCTTCTATGCTGCCCAGTACAGAGCTGGCTTTGACCTGGTCGTGTCACCCCTTGTCCATGCTATGTC

TGAACCCAACTTCATGGAAATCCCACCGCAGGTGCCAGTTAAGCGGAAATATCTCTTCACTTTCCAGGGCGAGAAGATCGAGTCTCTGAGATCTAGCCTT

CAGGAGGCCCGTTCCTTCGAGGAAGAGATGGAGGGCGACCCTCCGGCCGACTATGACGATCGCATCATTGCCACCCTAAAGGCCGTACAGGACAGCAAGC

TGGATCAGGTGCTGGTAGAATTCACTTGCAAAAACCAGCCGAAGCCCAGCCTGCCGACTGAGTGGGCACTGTGTGGGGAGCGGGAAGACCGCCTGGAGTT

ACTGAAGCTCTCCACCTTCGCCCTCATCATCACTCCCGGGGACCCGCACCTGCTCATTTCATCTGGGTGTGCCACGCGGCTCTTCGAGGCCCTGGAGGTG

GGGGCCGTGCCGGTGGTGCTCGGGGAGCAGGTGCAGCTCCCGTACCACGACATGCTGCAGTGGAACGAGGCCGCCCTGGTGGTGCCCAAGCCTCGCGTCA

CAGAGGTCCACTTCCTGTTACGAAGTCTTTCAGACAGTGATCTGTTGGCCATGAGGCGGCAAGGCCGCTTTCTCTGGGAGACCTACTTCTCCACCGCAGA

CAGTATTTTTAATACCGTGCTGGCCATGATTAGGACTCGAATTCAGATCCCAGCTGCTCCCATCCGGGAAGAGGTAGCGGCTGAGATCCCCCATCGTTCA

GGCAAAGCAGCTGGAACTGACCCCAACATGGCTGACAATGGGGACCTGGACCTGGGGCCGGTAGAGACAGAACCACCCTATGCCTCACCTAAATACCTCC

GCAATTTCACTCTGACTGTCACAGACTGTTACCGTGGCTGGAACTCTGCCCCGGGACCCTTCCATCTTTTTCCCCACACACCCTTTGATCCTGTGTTGCC

CTCTGAGGCCAAATTCCTGGGCTCAGGGACTGGATTTCGGCCCATCGGTGGCGGGGCTGGGGGCTCTGGCAAGGAGTTCCAGGCAGCGCTCGGAGGCAAT

GTCCAGCGGGAGCAGTTCACAGTTGTGATGCTGACCTACGAGCGGGAGGAAGTGCTCATGAACTCCCTGGAGAGACTCAACGGCCTCCCCTACCTGAACA

AGGTAGTGGTGGTGTGGAACTCTCCCAAGCTGCCCTCGGAGGACCTTTTGTGGCCAGACATTGGTGTCCCCATCATG - UNI9503 - GTCGTCCGTA

CTGAGAAGAACAGTTTGAACAATCGGTTCTTGCCCTGGAATGAGATTGAGACAGAGGCCATACTGTCCATCGACGATGATGCTCACCTCCGCCATGATGA

AATCATGTTTGGGTTTCG - UNI21389 - GGTGTGGAGAGAAGCACGTGATCGCATTGTGGGTTTCCCTGGCCGGTACCATGCGTGGGACATACCAC

ACCAGTCCTGGCTCTACAATTCCAACTACTCCTGTGAGCTGTCCATGGTGCTGACGGGCGCTGCCTTCTTTCACAAG TATTATGCCTACCTGTATTCTT

ATGTGATGCCCCAGGCCATCCGGGACATGGTGGACGAGTACATCAACTGTGAGGATATCGCCATGAACTTCCTTGTCTCCCACATCACACGGAAACCCCC

CATCAAG GTGACATCAAGGTGGACTTTTCGATGCCCAGGGTGCCCTCAGGCCCTGTCCCATGATGACTCTCATTTTCACGAGCGGCACAAGTGTATCAA

CTTTTTTGTCAAGGTGTACGGCTATATGCCTCTCTTGTACACACAGTTCAGGGTGGACTCCGTGCTCTTCAAGACCCGCCTGCCCCATGACAAGACCAAG

TGCTTCAAGTTCATCTAGGGCCTTGCCAGTTCTGAGGAGACGATGAGCAGAGCGAGGGGAGTCACCCTCAAGGTTCCCAAGGTGTCGAAGGTCCTTGGGG

ACATCTGTCGGGCAGGGCCAAGACCCTTTGCTGGGAGAGGCAGCAGGAAGAGTGGAAAGGGATAGCTGTCTTTCATTTTGAAGTCAGCCACACTGGGCCT

GGGATCCTGGTCAGCAGACTCAGGGCGTCTGCACAGGGCACTGACTGATAGCGAACACTGAGGACTGTTCATAAGCCCAGGACAGCTGCTTCGTGGTTTT

TAAATTCAGTAACAGCTATTATTATTTAAAGAGAGAATTTCACATCTGCCATTCAAGGCTTATTTATATGTGTGCGTATATGTACACACATATGTGTATA

TACGTATATATGCACACACACATACACACACATTCATACATACATTCATACATACATACATACATACACATATATATATTTTGGTGGGTCGGGGTGCACC

TGAAATTTCTGCCAATCTCTCCAAGGGAGGGTCCTACCCAGCTATGTATTTAGTGGAGAGGGCCCTGGCCCTGCGTTACCTGGACATTCATTTGCGGTCC

CCCCCGTCCCAGGGACACTGGCTGCAGAAATAAGCAGGATGGGCCTGACCTAGGCAGGGTCTCCTGACCTCTCCTGGCCCCGTTCCAATGCCACAGTGCT

GCTCCCACAGCTTGCCCCGCTGTAGGCTGCACAGTGGGGACGACACACCCCGGACGCTTTGAAGGGTTGGGCCAGGCCGCACTCAGGCATCACCTGGCTT

TCCATTCTTTCTTGTGTTTGAGAGAGAAGGAGGCGGCAGACAGTGAGGCAGAGATGAGACCTGTACGTAGCTCCCCCCCTCCCCCCCCCCCCGGGGTGAC

ACTGGTGCAGGGTGCTGGTGGCCAGTTCCGTGGTACTTGTTTCTCACAGAGGAGACAACAGGAACTTGGCAGGCTGGCTGGGAGCTCGGCGGGTGTAGAG

CCAGCCTGGGTCCTTCCGGGATTCTGTAGTCTTACTGCAAGGCTTTGGAAGGAACACCGAAGTGAAATTCACCTTCCCTCTTGTGTCTAGAAGTCCATCC

TGTAGCTGTGGGCTTTAGACCCCTGATGCCACGTTGGCTGTACGAGCCCCCCCTCCCCCCAACCTTCAAAGTCTAGGGTGGGCTAGAACCCGGAGGCTGT

GATTTGCTAGGTAAGTCCTAGTCTTGTCGTAGACGTTAACAGGAATTCACCCCACGTTACCACTTTCCATGTCCTGTTGATGGTTTTCTTCCCAGGGCTG

AAAATGAAATAAACTAACTTGGGGTATGGTGGCAGTGGGAAACTTAGGTCAGGGATTTGGCCTGTGACTTGTCTCCCCAGCCCCAGCAGCTGACGCAGAG

CTCAGTCTGTCTTGGTCATGCACCTGCCTTAAGCCAGTTCCGTCTTCCTAGGCCCTGACACGTGTGCTGCTGCTTGCTGTCCTCTGCCTGCTGTCCTGAC

TTCTCTCTAGATCCCTCCTGCCGTAGGGCTGGCATGGCCCCCGGGAGACCCTCAGGCCAGCAGGACCAGGCTGCTGCAGAACTTCACTGGGTCTTCTGGA

ACCTGACACCAAGGGCTGCCTGGGACATCTGGTTCTTGGCAACTCAGTGAAGGGGTCAAGACTGTTTCCCAACCTTCTGTCCTCTCATCAGCCCTTGTAG

CAGTAGCCCTCTTCCCCCGGGGGAGCCAAAGAGTGTGGTGTTTTGCGCTAAATATGTGGCTGCTATTTTATCTTTTTTTTTTCCTCTCCCAGTATTGGGG

ATGGACGCCAGAGCTGTGGGTGGACATCCCGACAATCGCTCTGCCCTGAGCCCTGTCCCTATTGTCTCGTTTCTTTTCATTGAGAGGTTGTAAATGGTGC

TGTGGTACCTGATAAGAAAGTCAGTCTCTGTGGTAGGACCCCCTCTGTGGGTCACTCATGGGTATCATTGATCTGTGTTTGAGGGATAGTGATGTCAAGA

GTGTCCTAGGGGATAGCCCTCTGGGCCTGGTGGGAACGCTCACTGAAGGACCCCAGCAGCAAACATTGGCAGTGACTGTACCTGAGGGACTCTTGTCAGA

GGCAAGAGGCAGAGACAAAGCAGTTGGACCCTGCTTGTGATTTGGGTTTTGGGGTTAGGGACATGCTTGGAAATGATTGTGCCACTACACGTCCGTGGAG

CCTGCCTGGTGTTTGACGTTGTTTACCATGGGTCACCTCCTAGAGCAGATTGCTAACACAGGTCACACTCAGCTACCTAGTCTCAGCTCCAGGGCCAGGA

CAGCTTTGTTTTCCAGTTGCTCTTCATCTTAAGGTCAAAGGCCACCCACAGAGTGACAGCCCCCCGGGATGCCTCAGGCCACCACCTAATGCTCCTGTCA

GGGGTGGCCTTGTTAGTGAACATGGAGCTGGAGGGTGGGGCCGCCTGGGGTGGCTTTGATGACTTGTCCATCTGTCTGCCCCTTTCAAACCATGAGCACA

AAGGTCTTACGTTGGATTTTTGTAAAAAACAAAAAACAAAAAACAAAATAAATGGAGACTTTAACTC
Translation
MTGYTMLRNGGVGNGGQTCMLRWSNRIRLTWLSFTLFIILVFFPLIAHYYLTTLDEADEAGKRIFGPRAGSELCEVKHVLDLCRIRESVSEELLQLEAKR

QELNSEIAKLNLKIEACKKSIENAKQDLLQLKNVISQTEHSYKELMAQNQPKLSLPIRLLPEKDDAGLPPPKVTRGCRLHNCFDYSRCPLTSGFPVYVYD

SDQFAFGSYLDPLVKQAFQATVRANVYVTENAAIACLYVVLVGEMQEPTVLRPADLEKQLFSLPHWRTDGHNHVIINLSRKSDTQNLLYNVSTGRAMVAQ

STFYAAQYRAGFDLVVSPLVHAMSEPNFMEIPPQVPVKRKYLFTFQGEKIESLRSSLQEARSFEEEMEGDPPADYDDRIIATLKAVQDSKLDQVLVEFTC

KNQPKPSLPTEWALCGEREDRLELLKLSTFALIITPGDPHLLISSGCATRLFEALEVGAVPVVLGEQVQLPYHDMLQWNEAALVVPKPRVTEVHFLLRSL

SDSDLLAMRRQGRFLWETYFSTADSIFNTVLAMIRTRIQIPAAPIREEVAAEIPHRSGKAAGTDPNMADNGDLDLGPVETEPPYASPKYLRNFTLTVTDC

YRGWNSAPGPFHLFPHTPFDPVLPSEAKFLGSGTGFRPIGGGAGGSGKEFQAALGGNVQREQFTVVMLTYEREEVLMNSLERLNGLPYLNKVVVVWNSPK

LPSEDLLWPDIGVPIM - UNI9503 - VVRTEKNSLNNRFLPWNEIETEAILSIDDDAHLRHDEIMFGFR - UNI21389 - RVWREARDRIVGFP

GRYHAWDIPHQSWLYNSNYSCELSMVLTGAAFFHK YYAYLYSYVMPQAIRDMVDEYINCEDIAMNFLVSHITRKPPIK VTSRWTFRCPGCPQALSHDD

SHFHERHKCINFFVKVYGYMPLLYTQFRVDSVLFKTRLPHDKTKCFKFI
Transcript ENSMUST00000022550
Sequence
ATCAGGAGAACAAGCTCTGGTGTCCATTAGTTCAAGAAATCCTGTGTTGAAGCATAATGTTGCTACATAAGCCAGAGAAAGGAAGAGCGCTGCCA GCCT

GATCGTTGGTAGTGGCATGGAGGACGGGGCTGGCATTTCAGACTGCCAGCTGTTTTTACCAGCCGCTGCATCACTTGAATAGAAGCTATGCATATTGGCT

GGCCGACAAAGCCAAGGGACAAAAGCTATGGCCGTTAAAATGGTCCCTCTGAGTCCAGGGCTCTTTCCCTGGCTTTTAGCACCATGGATCTCTTCCTTTT

CATCCCATCAGCAATGTGGTACCTTCTTCTACTTGATGATGACAGCTGATACTTCAGATTTGCCTGACTAAGGTTAGAAACCTGAATTGCCGTGAGGAAG

ATGAAATTTCCATTTTACTTGGTGCCTTGTGCAGGGAGCACACTGATCCTTCCAGAAACTTGTGTGTGAAAAGAGGTTGCGTTTTGTCAGACAGACTCAT

GGTTATGGCGAGCGATCCGACGTGATCAGAGTGGGCAAGAGGCACAGCGAACTCATGACAGGCTATACCATGTTGCGGAATGGGGGAGTGGGGAACGGTG

GTCAGACCTGTATGCTGCGCTGGTCCAATCGCATCCGGCTGACATGGCTGAGTTTCACGCTGTTCATCATCCTCGTCTTCTTCCCCCTCATTGCTCACTA

TTACCTCACCACTCTGGACGAGGCAGACGAGGCTGGCAAGCGCATCTTCGGCCCTCGGGCTGGCAGTGAGCTCTGTGAGGTAAAGCACGTCCTCGATCTC

TGTCGGATTCGTGAGTCTGTGAGCGAAGAGCTTCTACAGCTCGAAGCCAAGCGGCAGGAGCTGAACAGCGAGATTGCCAAGCTGAACCTCAAGATTGAAG

CCTGTAAGAAGAGCATAGAGAATGCCAAGCAGGACCTGCTGCAGCTCAAGAATGTCATTAGCCAGACAGAGCACTCCTACAAGGAGCTGATGGCCCAGAA

CCAGCCCAAACTGTCCCTGCCCATCCGACTGCTCCCCGAGAAGGACGATGCCGGCCTTCCACCCCCCAAGGTCACTCGGGGTTGCCGCCTTCACAACTGC

TTTGATTACTCTCGTTGTCCTCTGACGTCTGGCTTTCCCGTCTACGTCTATGACAGTGACCAGTTTGCCTTTGGGAGCTACCTGGACCCTTTGGTCAAGC

AGGCTTTTCAGGCTACAGTGAGAGCCAACGTTTATGTTACAGAAAATGCGGCCATCGCCTGCCTGTATGTGGTGTTAGTGGGAGAAATGCAAGAGCCCAC

TGTGCTGCGGCCTGCCGACCTTGAAAAGCAGCTGTTTTCTCTGCCACACTGGAGGACAGATGGGCACAACCACGTCATTATCAACCTGTCCCGGAAGTCA

GACACACAGAATCTACTGTACAACGTCAGTACAGGCCGGGCCATGGTGGCCCAGTCCACCTTCTATGCTGCCCAGTACAGAGCTGGCTTTGACCTGGTCG

TGTCACCCCTTGTCCATGCTATGTCTGAACCCAACTTCATGGAAATCCCACCGCAGGTGCCAGTTAAGCGGAAATATCTCTTCACTTTCCAGGGCGAGAA

GATCGAGTCTCTGAGATCTAGCCTTCAGGAGGCCCGTTCCTTCGAGGAAGAGATGGAGGGCGACCCTCCGGCCGACTATGACGATCGCATCATTGCCACC

CTAAAGGCCGTACAGGACAGCAAGCTGGATCAGGTGCTGGTAGAATTCACTTGCAAAAACCAGCCGAAGCCCAGCCTGCCGACTGAGTGGGCACTGTGTG

GGGAGCGGGAAGACCGCCTGGAGTTACTGAAGCTCTCCACCTTCGCCCTCATCATCACTCCCGGGGACCCGCACCTGCTCATTTCATCTGGGTGTGCCAC

GCGGCTCTTCGAGGCCCTGGAGGTGGGGGCCGTGCCGGTGGTGCTCGGGGAGCAGGTGCAGCTCCCGTACCACGACATGCTGCAGTGGAACGAGGCCGCC

CTGGTGGTGCCCAAGCCTCGCGTCACAGAGGTCCACTTCCTGTTACGAAGTCTTTCAGACAGTGATCTGTTGGCCATGAGGCGGCAAGGCCGCTTTCTCT

GGGAGACCTACTTCTCCACCGCAGACAGTATTTTTAATACCGTGCTGGCCATGATTAGGACTCGAATTCAGATCCCAGCTGCTCCCATCCGGGAAGAGGT

AGCGGCTGAGATCCCCCATCGTTCAGGCAAAGCAGCTGGAACTGACCCCAACATGGCTGACAATGGGGACCTGGACCTGGGGCCGGTAGAGACAGAACCA

CCCTATGCCTCACCTAAATACCTCCGCAATTTCACTCTGACTGTCACAGACTGTTACCGTGGCTGGAACTCTGCCCCGGGACCCTTCCATCTTTTTCCCC

ACACACCCTTTGATCCTGTGTTGCCCTCTGAGGCCAAATTCCTGGGCTCAGGGACTGGATTTCGGCCCATCGGTGGCGGGGCTGGGGGCTCTGGCAAGGA

GTTCCAGGCAGCGCTCGGAGGCAATGTCCAGCGGGAGCAGTTCACAGTTGTGATGCTGACCTACGAGCGGGAGGAAGTGCTCATGAACTCCCTGGAGAGA

CTCAACGGCCTCCCCTACCTGAACAAGGTAGTGGTGGTGTGGAACTCTCCCAAGCTGCCCTCGGAGGACCTTTTGTGGCCAGACATTGGTGTCCCCATCA

TG - UNI9503 - GTCGTCCGTACTGAGAAGAACAGTTTGAACAATCGGTTCTTGCCCTGGAATGAGATTGAGACAGAGGCCATACTGTCCATCGACG

ATGATGCTCACCTCCGCCATGATGAAATCATGTTTGGGTTTCG - UNI21389 - GGTGTGGAGAGAAGCACGTGATCGCATTGTGGGTTTCCCTGGC

CGGTACCATGCGTGGGACATACCACACCAGTCCTGGCTCTACAATTCCAACTACTCCTGTGAGCTGTCCATGGTGCTGACGGGCGCTGCCTTCTTTCACA

AG TATTATGCCTACCTGTATTCTTATGTGATGCCCCAGGCCATCCGGGACATGGTGGACGAGTACATCAACTGTGAGGATATCGCCATGAACTTCCTTG

TCTCCCACATCACACGGAAACCCCCCATCAAG GTGACATCAAGGTGGACTTTTCGATGCCCAGGGTGCCCTCAGGCCCTGTCCCATGATGACTCTCATT

TTCACGAGCGGCACAAGTGTATCAACTTTTTTGTCAAGGTGTACGGCTATATGCCTCTCTTGTACACACAGTTCAGGGTGGACTCCGTGCTCTTCAAGAC

CCGCCTGCCCCATGACAAGACCAAGTGCTTCAAGTTCATCTAGGGCCTTGCCAGTTCTGAGGAGACGATGAGCAGAGCGAGGGGAGTCACCCTCAAGGTT

CCCAAGGTGTCGAAGGTCCTTGGGGACATCTGTCGGGCAGGGCCAAGACCCTTTGCTGGGAGAGGCAGCAGGAAGAGTGGAAAGGGATAGCTGTCTTTCA

TTTTGAAGTCAGCCACACTGGGCCTGGGATCCTGGTCAGCAGACTCAGGGCGTCTGCACAGGGCACTGACTGATAGCGAACACTGAGGACTGTTCATAAG

CCCAGGACAGCTGCTTCGTGGTTTTTAAATTCAGTAACAGCTATTATTATTTAAAGAGAGAATTTCACATCTGCCATTCAAGGCTTATTTATATGTGTGC

GTATATGTACACACATATGTGTATATACGTATATATGCACACACACATACACACACATTCATACATACATTCATACATACATACATACATACACATATAT

ATATTTTGGTGGGTCGGGGTGCACCTGAAATTTCTGCCAATCTCTCCAAGGGAGGGTCCTACCCAGCTATGTATTTAGTGGAGAGGGCCCTGGCCCTGCG

TTACCTGGACATTCATTTGCGGTCCCCCCCGTCCCAGGGACACTGGCTGCAGAAATAAGCAGGATGGGCCTGACCTAGGCAGGGTCTCCTGACCTCTCCT

GGCCCCGTTCCAATGCCACAGTGCTGCTCCCACAGCTTGCCCCGCTGTAGGCTGCACAGTGGGGACGACACACCCCGGACGCTTTGAAGGGTTGGGCCAG

GCCGCACTCAGGCATCACCTGGCTTTCCATTCTTTCTTGTGTTTGAGAGAGAAGGAGGCGGCAGACAGTGAGGCAGAGATGAGACCTGTACGTAGCTCCC

CCCCTCCCCCCCCCCCCGGGGTGACACTGGTGCAGGGTGCTGGTGGCCAGTTCCGTGGTACTTGTTTCTCACAGAGGAGACAACAGGAACTTGGCAGGCT

GGCTGGGAGCTCGGCGGGTGTAGAGCCAGCCTGGGTCCTTCCGGGATTCTGTAGTCTTACTGCAAGGCTTTGGAAGGAACACCGAAGTGAAATTCACCTT

CCCTCTTGTGTCTAGAAGTCCATCCTGTAGCTGTGGGCTTTAGACCCCTGATGCCACGTTGGCTGTACGAGCCCCCCCTCCCCCCAACCTTCAAAGTCTA

GGGTGGGCTAGAACCCGGAGGCTGTGATTTGCTAGGTAAGTCCTAGTCTTGTCGTAGACGTTAACAGGAATTCACCCCACGTTACCACTTTCCATGTCCT

GTTGATGGTTTTCTTCCCAGGGCTGAAAATGAAATAAACTAACTTGGGGTATGGTGGCAGTGGGAAACTTAGGTCAGGGATTTGGCCTGTGACTTGTCTC

CCCAGCCCCAGCAGCTGACGCAGAGCTCAGTCTGTCTTGGTCATGCACCTGCCTTAAGCCAGTTCCGTCTTCCTAGGCCCTGACACGTGTGCTGCTGCTT

GCTGTCCTCTGCCTGCTGTCCTGACTTCTCTCTAGATCCCTCCTGCCGTAGGGCTGGCATGGCCCCCGGGAGACCCTCAGGCCAGCAGGACCAGGCTGCT

GCAGAACTTCACTGGGTCTTCTGGAACCTGACACCAAGGGCTGCCTGGGACATCTGGTTCTTGGCAACTCAGTGAAGGGGTCAAGACTGTTTCCCAACCT

TCTGTCCTCTCATCAGCCCTTGTAGCAGTAGCCCTCTTCCCCCGGGGGAGCCAAAGAGTGTGGTGTTTTGCGCTAAATATGTGGCTGCTATTTTATCTTT

TTTTTTTCCTCTCCCAGTATTGGGGATGGACGCCAGAGCTGTGGGTGGACATCCCGACAATCGCTCTGCCCTGAGCCCTGTCCCTATTGTCTCGTTTCTT

TTCATTGAGAGGTTGTAAATGGTGCTGTGGTACCTGATAAGAAAGTCAGTCTCTGTGGTAGGACCCCCTCTGTGGGTCACTCATGGGTATCATTGATCTG

TGTTTGAGGGATAGTGATGTCAAGAGTGTCCTAGGGGATAGCCCTCTGGGCCTGGTGGGAACGCTCACTGAAGGACCCCAGCAGCAAACATTGGCAGTGA

CTGTACCTGAGGGACTCTTGTCAGAGGCAAGAGGCAGAGACAAAGCAGTTGGACCCTGCTTGTGATTTGGGTTTTGGGGTTAGGGACATGCTTGGAAATG

ATTGTGCCACTACACGTCCGTGGAGCCTGCCTGGTGTTTGACGTTGTTTACCATGGGTCACCTCCTAGAGCAGATTGCTAACACAGGTCACACTCAGCTA

CCTAGTCTCAGCTCCAGGGCCAGGACAGCTTTGTTTTCCAGTTGCTCTTCATCTTAAGGTCAAAGGCCACCCACAGAGTGACAGCCCCCCGGGATGCCTC

AGGCCACCACCTAATGCTCCTGTCAGGGGTGGCCTTGTTAGTGAACATGGAGCTGGAGGGTGGGGCCGCCTGGGGTGGCTTTGATGACTTGTCCATCTGT

CTGCCCCTTTCAAACCATGAGCACAAAGGTCTTACGTTGGATTTTTGTAAAAAACAAAAAACAAAAAACAAAATAAATGGAGACTTTAACTC
Translation
 MTGYTMLRNGGVGNGGQTCMLRWSNRIRLTWLSFTLFIILVFFPLIAHYYLTTLDEADEAGKRIFGPRAGSELCEVKHVLDLCRIRESVSEELLQLEAK

RQELNSEIAKLNLKIEACKKSIENAKQDLLQLKNVISQTEHSYKELMAQNQPKLSLPIRLLPEKDDAGLPPPKVTRGCRLHNCFDYSRCPLTSGFPVYVY

DSDQFAFGSYLDPLVKQAFQATVRANVYVTENAAIACLYVVLVGEMQEPTVLRPADLEKQLFSLPHWRTDGHNHVIINLSRKSDTQNLLYNVSTGRAMVA

QSTFYAAQYRAGFDLVVSPLVHAMSEPNFMEIPPQVPVKRKYLFTFQGEKIESLRSSLQEARSFEEEMEGDPPADYDDRIIATLKAVQDSKLDQVLVEFT

CKNQPKPSLPTEWALCGEREDRLELLKLSTFALIITPGDPHLLISSGCATRLFEALEVGAVPVVLGEQVQLPYHDMLQWNEAALVVPKPRVTEVHFLLRS

LSDSDLLAMRRQGRFLWETYFSTADSIFNTVLAMIRTRIQIPAAPIREEVAAEIPHRSGKAAGTDPNMADNGDLDLGPVETEPPYASPKYLRNFTLTVTD

CYRGWNSAPGPFHLFPHTPFDPVLPSEAKFLGSGTGFRPIGGGAGGSGKEFQAALGGNVQREQFTVVMLTYEREEVLMNSLERLNGLPYLNKVVVVWNSP

KLPSEDLLWPDIGVPIM - UNI9503 - VVRTEKNSLNNRFLPWNEIETEAILSIDDDAHLRHDEIMFGFR - UNI21389 - RVWREARDRIVGF

PGRYHAWDIPHQSWLYNSNYSCELSMVLTGAAFFHK YYAYLYSYVMPQAIRDMVDEYINCEDIAMNFLVSHITRKPPIK VTSRWTFRCPGCPQALSHD

DSHFHERHKCINFFVKVYGYMPLLYTQFRVDSVLFKTRLPHDKTKCFKFI

For any suggestions or comments, please send an email to unitrap@crg.es