Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000021982 (Cdadc1)
Chromosomal location
Chr 14: 60182813 - 60216781 (-)
Description
cytidine and dCMP deaminase domain containing 1 Gene [Source:MGI Symbol;Acc:MGI:1919141]
RefSeq_dna
NM_027986 
RefSeq_peptide
NP_082262.1 
UniGene
Mm.443504 
MGI
MGI:1919141 
Uniprot/SWISSPROT
Q8BMD5 
Human Ortholog
ENSG00000102543 (CDADC1)
Omim not available
UniTrap UNI20073
Vector Insertion
Chr 14: 60208803 - 60211297
Public Clones not available
Private Clones OST373729 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000022555
Sequence
AGAACAAGCGGTTGTTGACAGGCCGCAGAGGTGGCCGTAGGCGAGCTTCAAGGAACCTATCATGCCTGACCGGGCAAGCTGTCCTGGGCCGAGGCCTTTG

GGCTGGGGATGAAAGAAACGGATCAGATGCAGAGTTTGGAGGGTTCCGGGGCCGAGAGGTCAGTCGGCACGCAGACGGGCAGCATGACGG GTCAAATAC

CAAGGCTTTCTAAAGTGAACCTTTTCACCCTGCTCAGTCTCTGGATGGAGCTCTTCCCAGGAGTGGAAGCCCAAGGGCAAAAATCTCAG AAAACTGAAG

AGGAAAGCCGTGGTCCCTTAGGAGACAATGAAGAGTTGACCAGAGTGTCTACTGAAAAAAAACAG - UNI20073 - GTGAAGAAAACTGGTCTTGTG

GTGGTGAAAAACATGAAGATCATTGGTCTTCACTGCTCCAGTGAAGACTTACATACTGGGCAAATTGCTCTCATTAAGCATGGGTCCAGGCTGAAAAACT

GTGATCTTTATTTTTCAAGAAAACCATGTTCTGCTTGTTTGAAAATGATAGTGAATG CTGGAGTTAACCGAATTTCTTACTGGCCTTCTGACCCAGAAA

TAAGTTTGCTCACTGAAGCTTCTAGTTCTGAAGATGCAAAGCTAGATGCCAAAGCCGCAGAAAGATTGAAGTCAAACAGCCGGGCCCATGTGTGTGTCTT

ACTCCAGCCGTTGGTGTGTTACATGGTGCAGTTTGTGGAGGAAACCTCTTACAAATGTGACTTTATTCAGAAAACTGCAAAAGCGTTGCCGGGTGCTGAC

ACTGATTTTTATTCTGAATGTAAACAAGAAAGAATAAAAGAGTATGAAATGTTATTTTTGGTTTCAAATGAAGAAAGGCATAAGCAGATACTGATGACTA

TAGGTCTGGAGAGCCTGTGTGAAGACCCCTATTTTAGCAATCTAAGGCAAAACATGAAAGACCTGATTCTACTTTTGGCCACAGTAGCTTCTAGTGTGCC

CAACTTGAAACACTTCGGATTCTACTGTAGCAGCCCAGAGCAGATTAATGAAATTCACAATCAGAGTTTGCCACAGGAAGTTGCAAGGCATTGCATGGTG

CAGGCCAGGTTATTGGCATATCGAACTG AGGATCATAAAACAGGAGTTGGAGCTGTCATTTGGGCAGAAGCGAAATCT AGAAGCTGCGATGGGACTGG

AGCCATGTACTTCATAGGGTGCGGGTACAATGCCTTTCCCGTGGGCTCTGAGTATGCCGACTTCCCGCACATGGATGACAAGCATAAGGACAGAGAAATA

CGGAAGTTCAGATACATCATACATGCGGAGCAGAACGCTTTGACATTTAG ATGTCAAGATATAAAACCAGAAGAACGCAGCATGATTTTTGTGACAAAA

TGCCCCTGTGATGAATGTGTGCCTTTAATTAAAGGTGCAGGCATAAAGCAGATCTATGCTGGTGACGTAGATGTTGGAAAGAAGAAAGCAGACATCTCGT

ACATGAAGTTTGGGGAGCTTGAGGGTGTTCGCAAATTCACA TGGCAGTTGAATCCGTCTGAAGCTTATAGTCTTGACCCAAATGAGCCTGAAAGGAGAG

AAA AGCATCTGTCCATCAAAAGATCCCACTAA
Translation
   - UNI20073 - MKIIGLHCSSEDLHTGQIALIKHGSRLKNCDLYFSRKPCSACLKMIVNA AGVNRISYWPSDPEISLLTEASSSEDAKLDAKAA

ERLKSNSRAHVCVLLQPLVCYMVQFVEETSYKCDFIQKTAKALPGADTDFYSECKQERIKEYEMLFLVSNEERHKQILMTIGLESLCEDPYFSNLRQNMK

DLILLLATVASSVPNLKHFGFYCSSPEQINEIHNQSLPQEVARHCMVQARLLAYRTE EDHKTGVGAVIWAEAKS RSCDGTGAMYFIGCGYNAFPVGSE

YADFPHMDDKHKDREIRKFRYIIHAEQNALTFR RCQDIKPEERSMIFVTKCPCDECVPLIKGAGIKQIYAGDVDVGKKKADISYMKFGELEGVRKFT W

QLNPSEAYSLDPNEPERREK KHLSIKRSH
Transcript ENSMUST00000056997
Sequence
AGAACAAGCGGTTGTTGACAGGCCGCAGAGGTGGCCGTAGGCGAGCTTCAAGGAACCTATCATGCCTGACCGGGCAAGCTGTCCTGGGCCGAGGCCTTTG

GGCTGGGGATGAAAGAAACGGATCAGATGCAGAGTTTGGAGGGTTCCGGGGCCGAGAGGTCAGTCGGCACGCAGACGGGCAGCATGACGG GTCAAATAC

CAAGGCTTTCTAAAGTGAACCTTTTCACCCTGCTCAGTCTCTGGATGGAGCTCTTCCCAGGAGTGGAAGCCCAAGGGCAAAAATCTCAG AAAACTGAAG

AGGAAAGCCGTGGTCCCTTAGGAGACAATGAAGAGTTGACCAGAGTGTCTACTGAAAAAAAACAG - UNI20073 - GTGAAGAAAACTGGTCTTGTG

GTGGTGAAAAACATGAAGATCATTGGTCTTCACTGCTCCAGTGAAGACTTACATACTGGGCAAATTGCTCTCATTAAGCATGGGTCCAGGCTGAAAAACT

GTGATCTTTATTTTTCAAGAAAACCATGTTCTGCTTGTTTGAAAATGATAGTGAATG CTGGAGTTAACCGAATTTCTTACTGGCCTTCTGACCCAGAAA

TAAGTTTGCTCACTGAAGCTTCTAGTTCTGAAGATGCAAAGCTAGATGCCAAAGCCGCAGAAAGATTGAAGTCAAACAGCCGGGCCCATGTGTGTGTCTT

ACTCCAGCCGTTGGTGTGTTACATGGTGCAGTTTGTGGAGGAAACCTCTTACAAATGTGACTTTATTCAGAAAACTGCAAAAGCGTTGCCGGGTGCTGAC

ACTGATTTTTATTCTGAATGTAAACAAGAAAGAATAAAAGAGTATGAAATGTTATTTTTGGTTTCAAATGAAGAAAGGCATAAGCAGATACTGATGACTA

TAGGTCTGGAGAGCCTGTGTGAAGACCCCTATTTTAGCAATCTAAGGCAAAACATGAAAGACCTGATTCTACTTTTGGCCACAGTAGCTTCTAGTGTGCC

CAACTTGAAACACTTCGGATTCTACTGTAGCAGCCCAGAGCAGATTAATGAAATTCACAATCAGAGTTTGCCACAGGAAGTTGCAAGGCATTGCATGGTG

CAGGCCAGGTTATTGGCATATCGAACTG AGGATCATAAAACAGGAGTTGGAGCTGTCATTTGGGCAGAAGCGAAATCT AGAAGCTGCGATGGGACTGG

AGCCATGTACTTCATAGGGTGCGGGTACAATGCCTTTCCCGTGGGCTCTGAGTATGCCGACTTCCCGCACATGGATGACAAGCATAAGGACAGAGAAATA

CGGAAGTTCAGATACATCATACATGCGGAGCAGAACGCTTTGACATTTAG ATGTCAAGATATAAAACCAGAAGAACGCAGCATGATTTTTGTGACAAAA

TGCCCCTGTGATGAATGTGTGCCTTTAATTAAAGGTGCAGGCATAAAGCAGATCTATGCTGGTGACGTAGATGTTGGAAAGAAGAAAGCAGACATCTCGT

ACATGAAGTTTGGGGAGCTTGAGGGTGTTCGCAAATTCACA TGGCAGTTGAATCCGTCTGAAGCTTATAGTCTTGACCCAAATGAGCCTGAAAGGAGAG

AAA ACGGTGTATTGAGGCGCAGGTCTGCAAAGGACGAACAGCGCAGCAGCAAGAGGCCACGTCTGGAAACCCGCTCTGCAGGTCGGGCTACACTGCAGT

AACCCACATGCTTTCTTACACGACTGAGAAACTCGTACGAGGCTGAACTGTAACTAGCCACAGAGTGGTGTTACCTCTGATCTTTTTATTTCAGATGTGT

TGCTCAGCATACAGTATATGATCTTCCAATATACTAAATGGAGTAGCAATAGTTTGAGACCAGTGTAAGAACAGTACCTACTGGTATTTATCCAGAGGTG

ATGCAGCCAGTTTGAGAAGGGATCATTCACAGGAGGCGATCTTCTTTTGATGGGTAGTTATTTTGGATTGCAAGGATGACAATTAATAAACTGCTCCAGG

GAATACGATGACCTGGCCATCTTTTAAGACTCCGTGTATAAATAACCAAAAGGCTGCATTACACTCAGTCCTTCTACCAGCCAGGACTTGCTGAAATAGA

TGGACTTAAAAGTTGCTGTGCCCATTCTCCATTTTACATGAGTTGTGTAAGTGGCCTGCAGATTTAGTTCAGTGGAGTAGTGTGTGCAAGCATGTGCAAG

GCCCTGAGTTCCCTCCTAAGCACC
Translation
MKETDQMQSLEGSGAERSVGTQTGSMTG GQIPRLSKVNLFTLLSLWMELFPGVEAQGQKSQ KTEEESRGPLGDNEELTRVSTEKKQ - UNI20073 

- VKKTGLVVVKNMKIIGLHCSSEDLHTGQIALIKHGSRLKNCDLYFSRKPCSACLKMIVNA AGVNRISYWPSDPEISLLTEASSSEDAKLDAKAAERL

KSNSRAHVCVLLQPLVCYMVQFVEETSYKCDFIQKTAKALPGADTDFYSECKQERIKEYEMLFLVSNEERHKQILMTIGLESLCEDPYFSNLRQNMKDLI

LLLATVASSVPNLKHFGFYCSSPEQINEIHNQSLPQEVARHCMVQARLLAYRTE EDHKTGVGAVIWAEAKS RSCDGTGAMYFIGCGYNAFPVGSEYAD

FPHMDDKHKDREIRKFRYIIHAEQNALTFR RCQDIKPEERSMIFVTKCPCDECVPLIKGAGIKQIYAGDVDVGKKKADISYMKFGELEGVRKFT WQLN

PSEAYSLDPNEPERREN NGVLRRRSAKDEQRSSKRPRLETRSAGRATLQ

For any suggestions or comments, please send an email to unitrap@crg.es