Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000022010 (Tsc22d1)
Chromosomal location
Chr 14: 76814768 - 76907569 (+)
Description
TSC22 domain family, member 1 Gene [Source:MGI (curated);Acc:Tsc22d1-006]
RefSeq_dna
NM_009366 NM_207652 
RefSeq_peptide
NP_033392.1 NP_997535.1 
UniGene
Mm.308763 Mm.153272 
MGI
MGI:109127 
Uniprot/SWISSPROT
P62500 
Uniprot/SPTREMBL
Q3UXU0 Q3UWN6 
Human Ortholog
ENSG00000102804 (TSC22D1)
Omim not available
UniTrap UNI29696
Vector Insertion
Chr 14: 76818817 - 76888242
Public Clones D109G01 (ggtc) E114F03 (ggtc) E114F02 (ggtc) IST14965D1 (tigm) IST11619D12 (tigm)
IST12439B6 (tigm) IST14425F2 (tigm) IST10879F4 (tigm) IST15103E8 (tigm)
IST14285H8 (tigm) IST10177E7 (tigm) IST11125C5 (tigm) IST12358E1 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI29932
Vector Insertion
Chr 14: 76888483 - 76903635
Public Clones E001C05 (ggtc)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI31838
Vector Insertion
Chr 14: 76904649 - 76905055
Public Clones IST10295E2 (tigm) IST11009A9 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 29% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI12835
Vector Insertion
Chr 14: 76905055 - 76905105
Public Clones CMHD-GT_371C2-3 (cmhd)
Private Clones OST471209 (lexicon) OST465881 (lexicon) OST348729 (lexicon) OST180446 (lexicon)
OST168523 (lexicon) OST70925 (lexicon) OST62385 (lexicon) OST60723 (lexicon)
OST6009 (lexicon)
Severity of mutation (?) Insertion after 29% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI2170
Vector Insertion
Chr 14: 76905105 - 76906223
Public Clones XT0138 (sanger) RRJ565 (baygenomics) CMHD-GT_163B12-3 (cmhd)
Private Clones OST18579 (lexicon) OST8557 (lexicon)
Severity of mutation (?) Insertion after 41% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000022587
Sequence
AGAGGAGTGGAGCCGGCAGCCGAGTAGGACCGAGCTGCTGCAGACGCGCCGGGTCACTCGAGCCAGCACCACCGTTCTCACGCCCTGAGCTGCAGACAGC

TAGGCGGTTTTATCTAGTTTGAACCAGGCTGCTGGAGCTTGCTCCCTCCCGCCCTCTCTCTTTTTTTTCCACGGGGCTGTTTTTTTAATTTGGCTGCAAT

TGCATGAAATCCCAATGGTGTAGACCAGTGGCGATGGATCTAGGAGTTTACCAACTGAGACATTTTTCCATTTCTTTCTTGTCGTCTTTGCTGGGAACCG

AAAACGCTTCCGTGAGACTTGACAATAG - UNI12835 - - UNI31838 - CTCTGGTGCAAGTGTGGTAGCTATCGACAACAAAATAGAGCAAGC

TATG - UNI2170 - - UNI12835 - GATCTGGTGAAAAGCCATTTGATGTATGCGGTGAGGGAGGAAGTGGAAGTTCTGAAGGAGCAGATCAAAG

AACTAATAGAGAAAAACTCCCAGCTGGAGCAGGAGAACAATCTGCTGAAGACGCTGGCCAGTCCGGAGCAGCTCGCCCAGTTTCAGGCCCAGCTGCAGAC

TGGCTCCCCTCCGGCCACCACGCAGCCACAGGGGACCACACAGCCCCCTGCACAGCCAGCATCCCAGGGCTCAGGATCAACCGCATAGCCTCCTAGGCCC

CAACAGAACTGGCTGCTGCTGCTGCTGTCTGAACTGAACAGACCGAAGAGATGTGCTAGAGAGAAGCCGCCTCCACAGTCACCCATTTCATTGCTGTCTA

CGAAAGAGACGTGAGACTCACACGCTGTTCTCGCTTTCTCCCCAGTATTAAGCACTCATAAGCTTTTGGCTTGAAGAAATGTACTAGTTGAGTGAATTAA

AGGTTAATCAGAGAGTGAGCAGGGATGTGCCCTGTGCAACGTGGCAGATGTCTGAGGAATGGTTTAATTGACCCCGAGGAGCTCTGTGCCTTTTCAACCC

TCCCCAGCCGCCCACCCTGCTTCTGAGAGCTCGGGCGGCTCGCCTTCGTGGGGCTCGCCTGCGTGGGGTTCGGAAAGTGGGCTGCTCCTGGATTCTGCGC

TCTCTTCTCCTTCCCTTCAAAGAACTCGGAGAGGCCAGAAACAAGACTGCAATGGGGGGCGGGGGGAGGGATGATGCAGTCCTTATACAAAACCGACAAC

TGTCACCAAAGCTTATAAAACACGATAGTACTGTCCCTCTTTTCTGAACCATCAGAAGACACAAAACTGTTAGTGACACAACGGTGACAGGTAGCTGGGA

CCTAGGCTATCTTATTATGAAGGTTGTTTTGCTTGTTGTATATTTGTGTATGTAGTGTAACGAATTTGTACCATAGAGGACTGTCCGTAACTACTGTTTA

GCTTCTACACATTGAAATGTAGATGTTTCATTGGCTGTCTGAAAAGGTGTGGCTTGTCCTTCCTAGAGAGATCTACTTAAAAACTGCTTTGTGACAAAAA

CCACACCTGAAGAAATTTTAAGAATTTGGCCCAGTTAGTCACTCTGTGTAATCCCGGAATCTAGCTGCTGAAGTCTTGCGAAGTAAACTCCCCGTGACCG

ATGTCAGTTAAGCTGGTGATACCTGGAGAAGTGGTCAGTTGCTAAGGAAGTGGATTTCCCAGTAGGGGTTTCTGCACCTCACCTGTATAGTCGTTCTGCG

CATGTCCCCCACACAGTCCCCACTGTATTTACCTGTTCTACTTGTCACCTTTCAATAAAGCATATCAAATGTTGAT
Translation
MKSQWCRPVAMDLGVYQLRHFSISFLSSLLGTENASVRLDNS - UNI12835 - - UNI31838 - SSGASVVAIDNKIEQAM - UNI2170 - -

 UNI12835 - DLVKSHLMYAVREEVEVLKEQIKELIEKNSQLEQENNLLKTLASPEQLAQFQAQLQTGSPPATTQPQGTTQPPAQPASQGSGSTA
Transcript ENSMUST00000100376
Sequence
ATTACTGATGCAGTTAGG - UNI12835 - - UNI31838 - CTCTGGTGCAAGTGTGGTAGCTATCGACAACAAAATAGAGCAAGCTATG - UNI

2170 - - UNI12835 - GATCTGGTGAAAAGCCATTTGATGTATGCGGTGAGGGAGGAAGTGGAAGTTCTGAAGGAGCAGATCAAAGAACTAATAGA

GAAAAACTCCCAGCTGGAGCAGGAGAACAATCTGCTGAAGACGCTGGCCAGTCCGGAGCAGCTCGCCCAGTTTCAGGCCCAGCTGCAGACTGGCTCCCCT

CCGGCCACCACGCAGCCACAGGGGACCACACAGCCCCCTGCACAGCCAGCATCCCAGGGCTCAGGATCAACCGCATAGCCTCCTAGGCCCCAACAGAACT

GGCTGCTGCTGCTGCTGTCTGAACTGAACAGACCGAAGAGATGTGCTAGAGAGAAGCCGCCTCCACAGTCACCCATTTCATTGCTGTCTACGAAAGAGAC

GTGAGACTCACACGCTGTTCTCGCTTTCTCCCCAGTATTAAGCACTCATAAGCTTTTGGCTTGAAGAAATGTACTAGTTGAGTGAATTAAAGGTTAATCA

GAGAGTGAGCAGGGATGTGCCCTGTGCAACGTGGCAGATGTCTGAGGAATGGTTTAATTGACCCCGAGGAGCTCTGTGCCTTTTCAACCCTCCCCAGCCG

CCCACCCTGCTTCTGAGAGCTCGGGCGGCTCGCCTTCGTGGGGCTCGCCTGCGTGGGGTTCGGAAAGTGGGCTGCTCCTGGATTCTGCGCTCTCTTCTCC

TTCCCTTCAAAGAACTCGGAGAGGCCAGAAACAAGACTGCAATGGGGGGCGGGGGGAGGGATGATGCAGTCCTTATACAAAACCGACAACTGTCACCAAA

GCTTATAAAACACGATAGTACTGTCCCTCTTTTCTGAACCATCAGAAGACACAAAACTGTTAGTGACACAACGGTGACAGGTAGCTGGGACCTAGGCTAT

CTTATTATGAAGGTTGTTTTGCTTGTTGTATATTTGTGTATGTAGTGTAACGAATTTGTACCATAGAGGACTGTCCGTAACTACTGTTTAGCTTCTACAC

ATTGAAATGTAGATGTTTCATTGGCTGTCTGAAAAGGTGTGGCTTGTCCTTCCTAGAGAGATCTACTTAAAAACTGCTTTGTGACAAAAACCACACCTGA

AGAAATTTTAAGAATTTGGCCCAGTTAGTCACTCTGTGTAATCCCGGAATCTAGCTGCTGAAGTCTTGCGAAGTAAACTCCCCGTGACCGATGTCAGTTA

AGCTGGTGATACCTGGAGAAGTGGTCAGTTGCTAAGGAAGTGGATTTCCCAGTAGGGGTTTCTGCACCTCACCTGTATAGTCGTTCTGCGCATGTCCCCC

ACACAGTCCCCACTGTATTTACCTGTTCTACTTGTCACCTTTCAATAAAGCATATCAAATGTTGAT
Translation
ITDAVR - UNI12835 - - UNI31838 - LWCKCGSYRQQNRASYG - UNI2170 - - UNI12835 - GSGEKPFDVCGEGGSGSSEGADQR

TNREKLPAGAGEQSAEDAGQSGAARPVSGPAADWLPSGHHAATGDHTAPCTASIPGLRINRIAS
Transcript ENSMUST00000101618
Sequence
TGGGAAGCCAACTCCACACCGGGAAATTGGAATCTGAGGGTCAGGGTCAGGGTCAGGTTCGAGCATCTGTGTTTTATAAAAGCTGCCTGCTTGTTTGTAG

AGTTCAGCCACAGTTAAGAGCCACCACTCAGCCGTAGCCCTTCCGTTAGGCAGAGACTGTGTCACTGTTAGGTGACTAGAGCTTCCTACTCTGCCAAGAT

CTGTGTGGGTAAGGAGAGAGCTCATGACAAAGGCTTTAAG - UNI12835 - - UNI29932 - - UNI31838 - CTCTGGTGCAAGTGTGGTAG

CTATCGACAACAAAATAGAGCAAGCTATG - UNI2170 - - UNI12835 - GATCTGGTGAAAAGCCATTTGATGTATGCGGTGAGGGAGGAAGTG

GAAGTTCTGAAGGAGCAGATCAAAGAACTAATAGAGAAAAACTCCCAGCTGGAGCAGGAGAACAATCTGCTGAAGACGCTGGCCAGTCCGGAGCAGCTCG

CCCAGTTTCAGGCCCAGCTGCAGACTGGCTCCCCTCCGGCCACCACGCAGCCACAGGGGACCACACAGCCCCCTGCACAGCCAGCATCCCAGGGCTCAGG

ATCAACCGCATAGCCTCCTAGGCCCCAACAGAACTGGCTGCTGCTGCTGCTGTCTGAACTGAACAGACCGAAGAGATGTGCTAGAGAGAAGCCGCCTCCA

CAGTCACCCATTTCATTGCTGTCTACGAAAGAGACGTGAGACTCACACGCTGTTCTCGCTTTCTCCCCAGTATTAAGCACTCATAAGCTTTTGGCTTGAA

GAAATGTACTAGTTGAGTGAATTAAAGGTTAATCAGAGAGTGAGCAGGGATGTGCCCTGTGCAACGTGGCAGATGTCTGAGGAATGGTTTAATTGACCCC

GAGGAGCTCTGTGCCTTTTCAACCCTCCCCAGCCGCCCACCCTGCTTCTGAGAGCTCGGGCGGCTCGCCTTCGTGGGGCTCGCCTGCGTGGGGTTCGGAA

AGTGGGCTGCTCCTGGATTCTGCGCTCTCTTCTCCTTCCCTTCAAAGAACTCGGAGAGGCCAGAAACAAGACTGCAATGGGGGGCGGGGGGAGGGATGAT

GCAGTCCTT
Translation
MTKALS - UNI12835 - - UNI29932 - - UNI31838 - SSGASVVAIDNKIEQAM - UNI2170 - - UNI12835 - DLVKSHLMYAV

REEVEVLKEQIKELIEKNSQLEQENNLLKTLASPEQLAQFQAQLQTGSPPATTQPQGTTQPPAQPASQGSGSTA
Transcript ENSMUST00000048371
Sequence
CTGGAGGGGGAAGTGAATGGCGAAGGACTGAAGGGGTCCCCCTTCGGTTCCCCAGCCACCTGGTTCACCCGGTTCATCCTCCCTTCCCGAAGTTAGCCCT

CGAAGGCACGAGCAGCCGGCGCCTTCGGCAGAGGAGGAGGAGGAGGAGGGATCGCGTCGGGCGGAGCTTCAGGTCCTGTTCGTCTCTCCGGCTTCTCCAT

ACAAAGATTACGGTGCAGAAGGAAATTGCACTTGCCTCCTCCGCCCCCCGGTACCCAGCACAATGCACCAGCCGCCGGAGTCCACCGCCGCGGCGGCCGC

TGCTGCAGACATTAGTGCTAGGAAGATGGCGCACCCGGCAATGTTCCCTCGAAGGGGCAGCGGTGGTGGCAGCGCCTCTGCTCTCAATGCAGCAGGTACG

GGCGTCAGTGGTGCTGCTCCATCTTCTGAAGATTTTCCTCCTCCTTCGCTGCTCCAGCCGCCGCCTCCTGCTGCATCTTCCACGCAGGGACCCCAGCCTC

CGCCTCCACAAAGCCTGAACCTCCTCTCGCAGGCTCAGCTGCAGGGACAGCCTCTTGCGCCAGGCGGAACTCAGATGAAAAAGAAAAGTGGCTTCCAGAT

AACTAGCGTTACTCCGGCTCAGATCTCTGCCAGCATCAGCTCCAACAACAGCATCGCGGAGGACACCGAGAGCTACGACGATCTGGATGAGTCGCACACG

GAAGATCTCTCCTCTTCCGAGATCCTCGACGTCTCCCTTTCCAGGGCCACTGACTTAGGTGAGCCTGAACGAAGCTCCTCAGAGGAGACTCTGAATAACT

TCCAGGAAGCTGAGACACCTGGGGCAGTCTCTCCTAACCAGCCCCACCTTCCTCAGCCTCATTTGCCTCACCTTCCACAACAGAACGTTGTGATCAATGG

GAATGCCCATCCCCACCACCTCCATCATCACCATCACCCTCATCATGGGCACCACCTTCACCATGGGCACCATCATTCATCACATGCTGCTGTGGCCGGT

CCATCCATTCCCGGAGGGCCACCCTCGAGCCCAGTGTCCAGGAAACTCTCTACAACTGGAAGTTCTGATGGTGGTGTGCCAGTCGCACCTCCTCCTGCAG

TACCATCGAGTGGCTTACCAGCATCAGTGATGACGAACATCCGTACTCCAAGTACTACAGGAAGCCTAGGTATAAATTCGGTTACTGGCACGAGCGCTAC

GAATAATGTTAACATTGCTGCTGTGGGTAGTTTCAGTCCCAGTGTGACGAACAGCGTGCATGGTAATGCTAATATAAATACAAGCAATATCCCTAATGCT

GCTAGCATAAGTGGTGGGCCTGGAGTTACCAGTGTTGTTAATTCGAGTATCTTGAGTGGCATGGGCAATGGTACCGTTTCTTCCTCTCCTGTTGCTAACA

GTGTCCTTAATGCAGCTGCAGGTATCACTGTGGGAGTGGTTTCCAGTCAGCAGCAGCAGCAGCAGCAGCAGCAACCAACAGTTAACACATCGAGGTTCAG

GGTTGTGAAGTTAGACTCTACTTCTGAACCCTTTAAAAAAGGTCGATGGACTTGCACAGAATTCTATGAGAAGGAAAACGCTGTGCCAGCTACAGAAGGC

GTGGCCGTCAATAAAGTGGTGGAGACGGTGAAGCAAACCCCCACGGAAGCATCGTCCTCGGAGAGGGAGAGCACTAGTGGGAGTTCTGTGAGCAGTAGTG

TGAGCACACTGAGTCACTACACGGAGAGTGTGGGAAGTGGAGAGATGATGGGAGCCCCGGCTGTGGTGGCGCCGCAGCAGCCGCCGCTACCACCAGCGCC

TCCAGGTCTTCAAGGTGTGGCTCTCCAACAGCTAGAGTTCAGTAGCCCTGCTCCACAGAGTATTGCGGCGGTTAGTATGCCACAGAGTATTTCTCAGTCA

CAGATGTCACAAGTACAGTTACAGCCTCAAGAGTTGAGCTTTCAGCAGAAGCAGACTCTTCAGCCTGTCCCTCTGCAAGCCACCATGAGTGCCGCAACTG

GTATCCAGCCTTCCCCTGTCAGCGTGGTCGGCATCACGGCGGCTGTAGGTCAGCAGCCTTCTGTTTCCAGCCTGGCTCAACCGCAGCTGCCATATTCTCA

GACAGCTCCTCCCGTGCAAACTCCTCTTCCAGGGGCACCACCCCAGCAGTTACAATATGGGCAGCAGCAACCAATGGTTCCTGCGCAGATAGCCCCAGGC

CATGGCCAGCCAGTGACTCAAAATCCAACTTCAGAGTATGTGCAGCAGCAGCAGCAGCCAATATTTCAAGCAGCATTGTCCTCTGGGCAGTCCAGTTCCA

CGGGCACGGGGGCAGGAATATCAGTGATTCCTGTGGCTCAGGCACAGGGGATCCAGCTGCCAGGGCAGCCCACAGCAGTACAAACACAACCTGCAGGGGC

GGCTGGGCAGCCCATTGGCCAGGCTCAAACAGCAGTGTCCACTGTACCAACTGGCGGTCAGATTGCAAGTATCGGTCAACAGGCAAACATACCCACTGCA

GTACAGCAGCCCTCTACCCAAGTTACACCTTCAGTTATTCAGCAAGGTGCTCCTCCATCTTCACAAGTAGTCCTACCTGCTCCAACCGGGATCATTCATC

AGGGAGTTCAAACCCGTGCTTCAAGCCTTCCACAACAATTGGTCATTGCACCCCAGAGTACCTTGGTAACTGTGCCTCCCCAGCCACAGGGAGTAGAAAC

CGTGGCCCAAGGGGTTGTTTCCCAGCAGTTGCCCACAGGCAGTCCTCTGCCCTCTGCTAGCACTATTTCTGTTACAAATCAGGTTAGTTCAGCCGCTCCT

TCTGGAATGCCTTCTGTCCCAACAAACTTAGTTCCACCACAGAATATAGCACAACCCCCAGCCACCCAAAATGGCAGTTTGGTTCAAAGTGTTAGTCAAT

CTCCCTTGATAGCCACTAACATAAATTTGCCTTTGGCACAACAGATACCACTAAGTTCTACTCAGTTCTCTACACAATCATTAGCTCAGGCCATTGGAAG

CCAAATGGAAGATGCCAGGCGCCCAGCGGAGCCCTCCTTAGGCGGCTTACCTCAGACTATGAGTGGTGACAGTGGGGGAATGTCAGCAGTTTCAGATGGG

AGTAGCAGCAGCCTAGCAGCCCCTGCTTCTCTCTTCCCGTTGAAGGTGCTACCGCTGACAACACCCCTGGTGGATGGCGAGGACGAGAG - UNI12835

 - - UNI29696 - - UNI29932 - - UNI31838 - CTCTGGTGCAAGTGTGGTAGCTATCGACAACAAAATAGAGCAAGCTATG - UNI217

0 - - UNI12835 - GATCTGGTGAAAAGCCATTTGATGTATGCGGTGAGGGAGGAAGTGGAAGTTCTGAAGGAGCAGATCAAAGAACTAATAGAGAA

AAACTCCCAGCTGGAGCAGGAGAACAATCTGCTGAAGACGCTGGCCAGTCCGGAGCAGCTCGCCCAGTTTCAGGCCCAGCTGCAGACTGGCTCCCCTCCG

GCCACCACGCAGCCACAGGGGACCACACAGCCCCCTGCACAGCCAGCATCCCAGGGCTCAGGATCAACCGCATAGCCTCCTAGGCCCCAACAGAACTGGC

TGCTGCTGCTGCTGTCTGAACTGAACAGACCGAAGAGATGTGCTAGAGAGAAGCCGCCTCCACAGTCACCCATTTCATTGCTGTCTACGAAAGAGACGTG

AGACTCACACGCTGTTCTCGCTTTCTCCCCAGTATTAAGCACTCATAAGCTTTTGGCTTGAAGAAATGTACTAGTTGAGTGAATTAAAGGTTAATCAGAG

AGTGAGCAGGGATGTGCCCTGTGCAACGTGGCAGATGTCTGAGGAATGGTTTAATTGACCCCGAGGAGCTCTGTGCCTTTTCAACCCTCCCCAGCCGCCC

ACCCTGCTTCTGAGAGCTCGGGCGGCTCGCCTTCGTGGGGCTCGCCTGCGTGGGGTTCGGAAAGTGGGCTGCTCCTGGATTCTGCGCTCTCTTCTCCTTC

CCTTCAAAGAACTCGGAGAGGCCAGAAACAAGACTGCAATGGGGGGCGGGGGGAGGGATGATGCAGTCCTTATACAAAACCGACAACTGTCACCAAAGCT

TATAAAACACGATAGTACTGTCCCTCTTTTCTGAACCATCAGAAGACACAAAACTGTTAGTGACACAACGGTGACAGGTAGCTGGGACCTAGGCTATCTT

ATTATGAAGGTTGTTTTGCTTGTTGTATATTTGTGTATGTAGTGTAACGAATTTGTACCATAGAGGACTGTCCGTAACTACTGTTTAGCTTCTACACATT

GAAATGTAGATGTTTCATTGGCTGTCTGAAAAGGTGTGGCTTGTCCTTCCTAGAGAGATCTACTTAAAAACTGCTTTGTGACAAAAACCACACCTGAAGA

AATTTTAAGAATTTGGCCCAGTTAGTCACTCTGTGTAATCCCGGAATCTAGCTGCTGAAGTCTTGCGAAGTAAACTCCCCGTGACCGATGTCAGTTAAGC

TGGTGATACCTGGAGAAGTGGTCAGTTGCTAAGGAAGTGGATTTCCCAGTAGGGGTTTCTGCACCTCACCTGTATAGTCGTTCTGCGCATGTCCCCCACA

CAGTCCCCACTGTATTTACCTGTTCTACTTGTCACCTTTCAATAAAGCATATCAAATGTTGAT
Translation
MHQPPESTAAAAAAADISARKMAHPAMFPRRGSGGGSASALNAAGTGVSGAAPSSEDFPPPSLLQPPPPAASSTQGPQPPPPQSLNLLSQAQLQGQPLAP

GGTQMKKKSGFQITSVTPAQISASISSNNSIAEDTESYDDLDESHTEDLSSSEILDVSLSRATDLGEPERSSSEETLNNFQEAETPGAVSPNQPHLPQPH

LPHLPQQNVVINGNAHPHHLHHHHHPHHGHHLHHGHHHSSHAAVAGPSIPGGPPSSPVSRKLSTTGSSDGGVPVAPPPAVPSSGLPASVMTNIRTPSTTG

SLGINSVTGTSATNNVNIAAVGSFSPSVTNSVHGNANINTSNIPNAASISGGPGVTSVVNSSILSGMGNGTVSSSPVANSVLNAAAGITVGVVSSQQQQQ

QQQQPTVNTSRFRVVKLDSTSEPFKKGRWTCTEFYEKENAVPATEGVAVNKVVETVKQTPTEASSSERESTSGSSVSSSVSTLSHYTESVGSGEMMGAPA

VVAPQQPPLPPAPPGLQGVALQQLEFSSPAPQSIAAVSMPQSISQSQMSQVQLQPQELSFQQKQTLQPVPLQATMSAATGIQPSPVSVVGITAAVGQQPS

VSSLAQPQLPYSQTAPPVQTPLPGAPPQQLQYGQQQPMVPAQIAPGHGQPVTQNPTSEYVQQQQQPIFQAALSSGQSSSTGTGAGISVIPVAQAQGIQLP

GQPTAVQTQPAGAAGQPIGQAQTAVSTVPTGGQIASIGQQANIPTAVQQPSTQVTPSVIQQGAPPSSQVVLPAPTGIIHQGVQTRASSLPQQLVIAPQST

LVTVPPQPQGVETVAQGVVSQQLPTGSPLPSASTISVTNQVSSAAPSGMPSVPTNLVPPQNIAQPPATQNGSLVQSVSQSPLIATNINLPLAQQIPLSST

QFSTQSLAQAIGSQMEDARRPAEPSLGGLPQTMSGDSGGMSAVSDGSSSSLAAPASLFPLKVLPLTTPLVDGEDES - UNI12835 - - UNI29696

 - - UNI29932 - - UNI31838 - SSGASVVAIDNKIEQAM - UNI2170 - - UNI12835 - DLVKSHLMYAVREEVEVLKEQIKELIEK

NSQLEQENNLLKTLASPEQLAQFQAQLQTGSPPATTQPQGTTQPPAQPASQGSGSTA
Transcript ENSMUST00000110887
Sequence
ATGGCGCACCCGGCAATGTTCCCTCGAAGGGGCAGCGGTGGTGGCAGCGCCTCTGCTCTCAATGCAGCAGGTACGGGCGTCAGTGGTGCTGCTCCATCTT

CTGAAGATTTTCCTCCTCCTTCGCTGCTCCAGCCGCCGCCTCCTGCTGCATCTTCCACGCAGGGACCCCAGCCTCCGCCTCCACAAAGCCTGAACCTCCT

CTCGCAGGCTCAGCTGCAGGGACAGCCTCTTGCGCCAGGCGGAACTCAGATGAAAAAGAAAAGTGGCTTCCAGATAACTAGCGTTACTCCGGCTCAGATC

TCTGCCAGCATCAGCTCCAACAACAGCATCGCGGAGGACACCGAGAGCTACGACGATCTGGATGAGTCGCACACGGAAGATCTCTCCTCTTCCGAGATCC

TCGACGTCTCCCTTTCCAGGGCCACTGACTTAGGTGAGCCTGAACGAAGCTCCTCAGAGGAGACTCTGAATAACTTCCAGGAAGCTGAGACACCTGGGGC

AGTCTCTCCTAACCAGCCCCACCTTCCTCAGCCTCATTTGCCTCACCTTCCACAACAGAACGTTGTGATCAATGGGAATGCCCATCCCCACCACCTCCAT

CATCACCATCACCCTCATCATGGGCACCACCTTCACCATGGGCACCATCATTCATCACATGCTGCTGTGGCCGGTCCATCCATTCCCGGAGGGCCACCCT

CGAGCCCAGTGTCCAGGAAACTCTCTACAACTGGAAGTTCTGATGGTGGTGTGCCAGTCGCACCTCCTCCTGCAGTACCATCGAGTGGCTTACCAGCATC

AGTGATGACGAACATCCGTACTCCAAGTACTACAGGAAGCCTAGGTATAAATTCGGTTACTGGCACGAGCGCTACGAATAATGTTAACATTGCTGCTGTG

GGTAGTTTCAGTCCCAGTGTGACGAACAGCGTGCATGGTAATGCTAATATAAATACAAGCAATATCCCTAATGCTGCTAGCATAAGTGGTGGGCCTGGAG

TTACCAGTGTTGTTAATTCGAGTATCTTGAGTGGCATGGGCAATGGTACCGTTTCTTCCTCTCCTGTTGCTAACAGTGTCCTTAATGCAGCTGCAGGTAT

CACTGTGGGAGTGGTTTCCAGTCAGCAGCAGCAGCAGCAGCAGCAGCAACCAACAGTTAACACATCGAGGTTCAGGGTTGTGAAGTTAGACTCTACTTCT

GAACCCTTTAAAAAAGGTCGATGGACTTGCACAGAATTCTATGAGAAGGAAAACGCTGTGCCAGCTACAGAAGGCGTGGCCGTCAATAAAGTGGTGGAGA

CGGTGAAGCAAACCCCCACGGAAGCATCGTCCTCGGAGAGGGAGAGCACTAGTGGGAGTTCTGTGAGCAGTAGTGTGAGCACACTGAGTCACTACACGGA

GAGTGTGGGAAGTGGAGAGATGATGGGAGCCCCGGCTGTGGTGGCGCCGCAGCAGCCGCCGCTACCACCAGCGCCTCCAGGTCTTCAAGGTGTGGCTCTC

CAACAGCTAGAGTTCAGTAGCCCTGCTCCACAGAGTATTGCGGCGGTTAGTATGCCACAGAGTATTTCTCAGTCACAGATGTCACAAGTACAGTTACAGC

CTCAAGAGTTGAGCTTTCAGCAGAAGCAGACTCTTCAGCCTGTCCCTCTGCAAGCCACCATGAGTGCCGCAACTGGTATCCAGCCTTCCCCTGTCAGCGT

GGTCGGCATCACGGCGGCTGTAGGTCAGCAGCCTTCTGTTTCCAGCCTGGCTCAACCGCAGCTGCCATATTCTCAGACAGCTCCTCCCGTGCAAACTCCT

CTTCCAGGGGCACCACCCCAGCAGTTACAATATGGGCAGCAGCAACCAATGGTTCCTGCGCAGATAGCCCCAGGCCATGGCCAGCCAGTGACTCAAAATC

CAACTTCAGAGTATGTGCAGCAGCAGCAGCAGCCAATATTTCAAGCAGCATTGTCCTCTGGGCAGTCCAGTTCCACGGGCACGGGGGCAGGAATATCAGT

GATTCCTGTGGCTCAGGCACAGGGGATCCAGCTGCCAGGGCAGCCCACAGCAGTACAAACACAACCTGCAGGGGCGGCTGGGCAGCCCATTGGCCAGGCT

CAAACAGCAGTGTCCACTGTACCAACTGGCGGTCAGATTGCAAGTATCGGTCAACAGGCAAACATACCCACTGCAGTACAGCAGCCCTCTACCCAAGTTA

CACCTTCAGTTATTCAGCAAGGTGCTCCTCCATCTTCACAAGTAGTCCTACCTGCTCCAACCGGGATCATTCATCAGGGAGTTCAAACCCGTGCTTCAAG

CCTTCCACAACAATTGGTCATTGCACCCCAGAGTACCTTGGTAACTGTGCCTCCCCAGCCACAGGGAGTAGAAACCGTGGCCCAAGGGGTTGTTTCCCAG

CAGTTGCCCACAGGCAGTCCTCTGCCCTCTGCTAGCACTATTTCTGTTACAAATCAGGTTAGTTCAGCCGCTCCTTCTGGAATGCCTTCTGTCCCAACAA

ACTTAGTTCCACCACAGAATATAGCACAACCCCCAGCCACCCAAAATGGCAGTTTGGTTCAAAGTGTTAGTCAATCTCCCTTGATAGCCACTAACATAAA

TTTGCCTTTGGCACAACAGATACCACTAAGTTCTACTCAGTTCTCTACACAATCATTAGCTCAGGCCATTGGAAGCCAAATGGAAGATGCCAGGCGCCCA

GCGGAGCCCTCCTTAGGCGGCTTACCTCAGACTATGAGTGGTGACAGTGGGGGAATGTCAGCAGTTTCAGATGGGAGTAGCAGCAGCCTAGCAGCCCCTG

CTTCTCTCTTCCCGTTGAAGGTGCTACCGCTGACAACACCCCTGGTGGATGGCGAGGACGAGAG - UNI12835 - - UNI29696 - - UNI2993

2 - - UNI31838 - CTCTGGTGCAAGTGTGGTAGCTATCGACAACAAAATAGAGCAAGCTATG - UNI2170 - - UNI12835 - GATCTGGT

GAAAAGCCATTTGATGTATGCGGTGAGGGAGGAAGTGGAAGTTCTGAAGGAGCAGATCAAAGAACTAATAGAGAAAAACTCCCAGCTGGAGCAGGAGAAC

AATCTGCTGAAGACGCTGGCCAGTCCGGAGCAGCTCGCCCAGTTTCAGGCCCAGCTGCAGACTGGCTCCCCTCCGGCCACCACGCAGCCACAGGGGACCA

CACAGCCCCCTGCACAGCCAGCATCCCAGGGCTCAGGATCAACCGCATAGCCTCCTAGGCCCCAACAGAACTGGCTGCTGCTGCTGCTGTCTGAACTGAA

CAGACCGAAGAGATGTGCTAGAGAGAAGCCGCCTCCACAGTCACCCATTTCATTGCTGTCTACGAAAGAGACGTGAGACTCACACGCTGTTCTCGCTTTC

TCCCCAGTATTAAGCACTCATAAGCTTTTGGCTTGAAGAAATGTACTAGTTGAGTGAATTAAAGGTTAATCAGAGAGTGAGCAGGGATGTGCCCTGTGCA

ACGTGGCAGATGTCTGAGGAATGGTTTAATTGACCCCGAGGAGCTCTGTGCCTTTTCAACCCTCCCCAGCCGCCCACCCTGCTTCTGAGAGCTCGGGCGG

CTCGCCTTCGTGGGGCTCGCCTGCGTGGGGTTCGGAAAGTGGGCTGCTCCTGGATTCTGCGCTCTCTTCTCCTTCCCTTCAAAGAACTCGGAGAGGCCAG

AAACAAGACTGCAATGGGGGGCGGGGGGAGGGATGATGCAGTCCTTATACAAAACCGACAACTGTCACCAAAGCTTATAAAACACGATAGTACTGTCCCT

CTTTTCTGAACCATCAGAAGACACAAAACTGTTAGTGACACAACGGTGACAGGTAGCTGGGACCTAGGCTATCTTATTATGAAGGTTGTTTTGCTTGTTG

TATATTTGTGTATGTAGTGTAACGAATTTGTACCATAGAGGACTGTCCGTAACTACTGTTTAGCTTCTACACATTGAAATGTAGATGTTTCATTGGCTGT

CTGAAAAGGTGTGGCTTGTCCTTCCTAGAGAGATCTACTTAAAAACTGCTTTGTGACAAAAACCACACCTGAAGAAATTTTAAGAATTTGGCCCAGTTAG

TCACTCTGTGTAATCCCGGAATCTAGCTGCTGAAGTCTTGCGAAGTAAACTCCCCGTGACCGATGTCAGTTAAGCTGGTGATACCTGGAGAAGTGGTCAG

TTGCTAAGGAAGTGGATTTCCCAGTAGGGGTTTCTGCACCTCACCTGTATAGTCGTTCTGCGCATGTCCCCCACACAGTCCCCACTGTATTTACCTGTTC

TACTTGTCACCTTTCAATAAAGCATATCAAATGTTGAT
Translation
MAHPAMFPRRGSGGGSASALNAAGTGVSGAAPSSEDFPPPSLLQPPPPAASSTQGPQPPPPQSLNLLSQAQLQGQPLAPGGTQMKKKSGFQITSVTPAQI

SASISSNNSIAEDTESYDDLDESHTEDLSSSEILDVSLSRATDLGEPERSSSEETLNNFQEAETPGAVSPNQPHLPQPHLPHLPQQNVVINGNAHPHHLH

HHHHPHHGHHLHHGHHHSSHAAVAGPSIPGGPPSSPVSRKLSTTGSSDGGVPVAPPPAVPSSGLPASVMTNIRTPSTTGSLGINSVTGTSATNNVNIAAV

GSFSPSVTNSVHGNANINTSNIPNAASISGGPGVTSVVNSSILSGMGNGTVSSSPVANSVLNAAAGITVGVVSSQQQQQQQQQPTVNTSRFRVVKLDSTS

EPFKKGRWTCTEFYEKENAVPATEGVAVNKVVETVKQTPTEASSSERESTSGSSVSSSVSTLSHYTESVGSGEMMGAPAVVAPQQPPLPPAPPGLQGVAL

QQLEFSSPAPQSIAAVSMPQSISQSQMSQVQLQPQELSFQQKQTLQPVPLQATMSAATGIQPSPVSVVGITAAVGQQPSVSSLAQPQLPYSQTAPPVQTP

LPGAPPQQLQYGQQQPMVPAQIAPGHGQPVTQNPTSEYVQQQQQPIFQAALSSGQSSSTGTGAGISVIPVAQAQGIQLPGQPTAVQTQPAGAAGQPIGQA

QTAVSTVPTGGQIASIGQQANIPTAVQQPSTQVTPSVIQQGAPPSSQVVLPAPTGIIHQGVQTRASSLPQQLVIAPQSTLVTVPPQPQGVETVAQGVVSQ

QLPTGSPLPSASTISVTNQVSSAAPSGMPSVPTNLVPPQNIAQPPATQNGSLVQSVSQSPLIATNINLPLAQQIPLSSTQFSTQSLAQAIGSQMEDARRP

AEPSLGGLPQTMSGDSGGMSAVSDGSSSSLAAPASLFPLKVLPLTTPLVDGEDES - UNI12835 - - UNI29696 - - UNI29932 - - UNI

31838 - SSGASVVAIDNKIEQAM - UNI2170 - - UNI12835 - DLVKSHLMYAVREEVEVLKEQIKELIEKNSQLEQENNLLKTLASPEQLA

QFQAQLQTGSPPATTQPQGTTQPPAQPASQGSGSTA
Transcript ENSMUST00000110888
Sequence
GCGTCGGCTGCAGCCGCTGCACCAGCCCCGTCTGGCCGCCACCGCCGCGAAAAGGAGCCACCGCCGCCCGCGGCCCCCTCCCTCCCTCTCTCCCTCCCTC

CCGGTCGCGGGAGCAGCTCGGTGCCGAACCAGCCGGCGGGCCGAGAAGAGGACGCGAGCTCGCCCCTCCGCTCCCGCGCACGTCCCGCCGCCCGCCGGAG

CAGCCCGGGCGCCGGCGCCCTTCCTCTCCGAGGACGTGTGGCGAGCCGAGCGCCTGCCCCGAGGGAGGAAAATGCTCGGGCTCCATGGCTGCCAGTGATG

GAGCGGTCCCTGGGCTCCCGCTGCTGCTGCCGCCACCGCCGCCGCCGCCGCGCCCCGGCCGCGCTCCGCGAGGATCCGGCGTCTCTGCGCGCCCGCCCGC

GCCTCGTTGCTGGGCTCACCGTACCGGGCGCCCCGCCACCGCCCCGCTCGCAGCCGCGCCGCCCGGGCCCCAGCCGCGGCCAGCCTTTCCTCCCGGAGCA

GCCGTCGCGAGCCCAGGGGGTTTGAGAGGGGCCGCGGGCCGTGGGGGGAGGCCCGAGCGGGGCCGGCCGCGCCGGCAGGGGAGGTTGGAGCGACGCTGAG

CTCAGGGCTCGCCGGCGGCCGCGGCGCCGGGGGTGGCGAGGGCCGGGGCGACCGCTCGCTCCGCGCTGCCTCGGTGCAGGACGAGCGGAGGGGCTTTTGC

AGCGGCCGTCGCCGCGGGAGGAGGGGGTTGAGCTGGCTCCGGAGTTGGCCAAAGAAG CCCTCGAAGGCACGAGCAGCCGGCGCCTTCGGCAGAGGAGGA

GGAGGAGGAGGGATCGCGTCGGGCGGAGCTTCAGGTCCTGTTCGTCTCTCCGGCTTCTCCATACAAAGATTACGGTGCAGAAGGAAATTGCACTTGCCTC

CTCCGCCCCCCGGTACCCAGCACAATGCACCAGCCGCCGGAGTCCACCGCCGCGGCGGCCGCTGCTGCAGACATTAGTGCTAGGAAGATGGCGCACCCGG

CAATGTTCCCTCGAAGGGGCAGCGGTGGTGGCAGCGCCTCTGCTCTCAATGCAGCAGGTACGGGCGTCAGTGGTGCTGCTCCATCTTCTGAAGATTTTCC

TCCTCCTTCGCTGCTCCAGCCGCCGCCTCCTGCTGCATCTTCCACGCAGGGACCCCAGCCTCCGCCTCCACAAAGCCTGAACCTCCTCTCGCAGGCTCAG

CTGCAGGGACAGCCTCTTGCGCCAGGCGGAACTCAGATGAAAAAGAAAAGTGGCTTCCAGATAACTAGCGTTACTCCGGCTCAGATCTCTGCCAGCATCA

GCTCCAACAACAGCATCGCGGAGGACACCGAGAGCTACGACGATCTGGATGAGTCGCACACGGAAGATCTCTCCTCTTCCGAGATCCTCGACGTCTCCCT

TTCCAGGGCCACTGACTTAGGTGAGCCTGAACGAAGCTCCTCAGAGGAGACTCTGAATAACTTCCAGGAAGCTGAGACACCTGGGGCAGTCTCTCCTAAC

CAGCCCCACCTTCCTCAGCCTCATTTGCCTCACCTTCCACAACAGAACGTTGTGATCAATGGGAATGCCCATCCCCACCACCTCCATCATCACCATCACC

CTCATCATGGGCACCACCTTCACCATGGGCACCATCATTCATCACATGCTGCTGTGGCCGGTCCATCCATTCCCGGAGGGCCACCCTCGAGCCCAGTGTC

CAGGAAACTCTCTACAACTGGAAGTTCTGATGGTGGTGTGCCAGTCGCACCTCCTCCTGCAGTACCATCGAGTGGCTTACCAGCATCAGTGATGACGAAC

ATCCGTACTCCAAGTACTACAGGAAGCCTAG CTGCAGGTATCACTGTGGGAGTGGTTTCCAGTCAGCAGCAGCAGCAGCAGCAGCAGCAACCAACAGTT

AACACATCGAGGTTCAGGGTTGTGAAGTTAGACTCTACTTCTGAACCCTTTAAAAAAGGTCGATGGACTTGCACAGAATTCTATGAGAAGGAAAACGCTG

TGCCAGCTACAGAAGGCGTGGCCGTCAATAAAGTGGTGGAGACGGTGAAGCAAACCCCCACGGAAGCATCGTCCTCGGAGAGGGAGAGCACTAGTGGGAG

TTCTGTGAGCAGTAGTGTGAGCACACTGAGTCACTACACGGAGAGTGTGGGAAGTGGAGAGATGATGGGAGCCCCGGCTGTGGTGGCGCCGCAGCAGCCG

CCGCTACCACCAGCGCCTCCAGGTCTTCAAGGTGTGGCTCTCCAACAGCTAGAGTTCAGTAGCCCTGCTCCACAGAGTATTGCGGCGGTTAGTATGCCAC

AGAGTATTTCTCAGTCACAGATGTCACAAGTACAGTTACAGCCTCAAGAGTTGAGCTTTCAGCAGAAGCAGACTCTTCAGCCTGTCCCTCTGCAAGCCAC

CATGAGTGCCGCAACTGGTATCCAGCCTTCCCCTGTCAGCGTGGTCGGCATCACGGCGGCTGTAGGTCAGCAGCCTTCTGTTTCCAGCCTGGCTCAACCG

CAGCTGCCATATTCTCAGACAGCTCCTCCCGTGCAAACTCCTCTTCCAGGGGCACCACCCCAGCAGTTACAATATGGGCAGCAGCAACCAATGGTTCCTG

CGCAGATAGCCCCAGGCCATGGCCAGCCAGTGACTCAAAATCCAACTTCAGAGTATGTGCAGCAGCAGCAGCAGCCAATATTTCAAGCAGCATTGTCCTC

TGGGCAGTCCAGTTCCACGGGCACGGGGGCAGGAATATCAGTGATTCCTGTGGCTCAGGCACAGGGGATCCAGCTGCCAGGGCAGCCCACAGCAGTACAA

ACACAACCTGCAGGGGCGGCTGGGCAGCCCATTGGCCAGGCTCAAACAGCAGTGTCCACTGTACCAACTGGCGGTCAGATTGCAAGTATCGGTCAACAGG

CAAACATACCCACTGCAGTACAGCAGCCCTCTACCCAAGTTACACCTTCAGTTATTCAGCAAGGTGCTCCTCCATCTTCACAAGTAGTCCTACCTGCTCC

AACCGGGATCATTCATCAGGGAGTTCAAACCCGTGCTTCAAGCCTTCCACAACAATTGGTCATTGCACCCCAGAGTACCTTGGTAACTGTGCCTCCCCAG

CCACAGGGAGTAGAAACCGTGGCCCAAGGGGTTGTTTCCCAGCAGTTGCCCACAGGCAGTCCTCTGCCCTCTGCTAGCACTATTTCTGTTACAAATCAGG

TTAGTTCAGCCGCTCCTTCTGGAATGCCTTCTGTCCCAACAAACTTAGTTCCACCACAGAATATAGCACAACCCCCAGCCACCCAAAATGGCAGTTTGGT

TCAAAGTGTTAGTCAATCTCCCTTGATAGCCACTAACATAAATTTGCCTTTGGCACAACAGATACCACTAAGTTCTACTCAGTTCTCTACACAATCATTA

GCTCAGGCCATTGGAAGCCAAATGGAAGATGCCAGGCGCCCAGCGGAGCCCTCCTTAGGCGGCTTACCTCAGACTATGAGTGGTGACAGTGGGGGAATGT

CAGCAGTTTCAGATGGGAGTAGCAGCAGCCTAGCAGCCCCTGCTTCTCTCTTCCCGTTGAAGGTGCTACCGCTGACAACACCCCTGGTGGATGGCGAGGA

CGAGAG - UNI12835 - - UNI29696 - - UNI29932 - - UNI31838 - CTCTGGTGCAAGTGTGGTAGCTATCGACAACAAAATAGAGC

AAGCTATG - UNI2170 - - UNI12835 - GATCTGGTGAAAAGCCATTTGATGTATGCGGTGAGGGAGGAAGTGGAAGTTCTGAAGGAGCAGATC

AAAGAACTAATAGAGAAAAACTCCCAGCTGGAGCAGGAGAACAATCTGCTGAAGACGCTGGCCAGTCCGGAGCAGCTCGCCCAGTTTCAGGCCCAGCTGC

AGACTGGCTCCCCTCCGGCCACCACGCAGCCACAGGGGACCACACAGCCCCCTGCACAGCCAGCATCCCAGGGCTCAGGATCAACCGCATAGCCTCCTAG

GCCCCAACAGAACTGGCTGCTGCTGCTGCTGTCTGAACTGAACAGACCGAAGAGATGTGCTAGAGAGAAGCCGCCTCCACAGTCACCCATTTCATTGCTG

TCTACGAAAGAGACGTGAGACTCACACGCTGTTCTCGCTTTCTCCCCAGTATTAAGCACTCATAAGCTTTTGGCTTGAAGAAATGTACTAGTTGAGTGAA

TTAAAGGTTAATCAGAGAGTGAGCAGGGATGTGCCCTGTGCAACGTGGCAGATGTCTGAGGAATGGTTTAATTGACCCCGAGGAGCTCTGTGCCTTTTCA

ACCCTCCCCAGCCGCCCACCCTGCTTCTGAGAGCTCGGGCGGCTCGCCTTCGTGGGGCTCGCCTGCGTGGGGTTCGGAAAGTGGGCTGCTCCTGGATTCT

GCGCTCTCTTCTCCTTCCCTTCAAAGAACTCGGAGAGGCCAGAAACAAGACTGCAATGGGGGGCGGGGGGAGGGATGATGCAGTCCTTATACAAAACCGA

CAACTGTCACCAAAGCTTATAAAACACGATAGTACTGTCCCTCTTTTCTGAACCATCAGAAGACACAAAACTGTTAGTGACACAACGGTGACAGGTAGCT

GGGACCTAGGCTATCTTATTATGAAGGTTGTTTTGCTTGTTGTATATTTGTGTATGTAGTGTAACGAATTTGTACCATAGAGGACTGTCCGTAACTACTG

TTTAGCTTCTACACATTGAAATGTAGATGTTTCATTGGCTGTCTGAAAAGGTGTGGCTTGTCCTTCCTAGAGAGATCTACTTAAAAACTGCTTTGTGACA

AAAACCACACCTGAAGAAATTTTAAGAATTTGGCCCAGTTAGTCACTCTGTGTAATCCCGGAATCTAGCTGCTGAAGTCTTGCGAAGTAAACTCCCCGTG

ACCGATGTCAGTTAAGCTGGTGATACCTGGAGAAGTGGTCAGTTGCTAAGGAAGTGGATTTCCCAGTAGGGGTTTCTGCACCTCACCTGTATAGTCGTTC

TGCGCATGTCCCCCACACAGTCCCCACTGTATTTACCTGTTCTACTTGTCACCTTTCAATAAAGCATATCAAATGTTGAT
Translation
 MHQPPESTAAAAAAADISARKMAHPAMFPRRGSGGGSASALNAAGTGVSGAAPSSEDFPPPSLLQPPPPAASSTQGPQPPPPQSLNLLSQAQLQGQPLA

PGGTQMKKKSGFQITSVTPAQISASISSNNSIAEDTESYDDLDESHTEDLSSSEILDVSLSRATDLGEPERSSSEETLNNFQEAETPGAVSPNQPHLPQP

HLPHLPQQNVVINGNAHPHHLHHHHHPHHGHHLHHGHHHSSHAAVAGPSIPGGPPSSPVSRKLSTTGSSDGGVPVAPPPAVPSSGLPASVMTNIRTPSTT

GSLA AAGITVGVVSSQQQQQQQQQPTVNTSRFRVVKLDSTSEPFKKGRWTCTEFYEKENAVPATEGVAVNKVVETVKQTPTEASSSERESTSGSSVSSS

VSTLSHYTESVGSGEMMGAPAVVAPQQPPLPPAPPGLQGVALQQLEFSSPAPQSIAAVSMPQSISQSQMSQVQLQPQELSFQQKQTLQPVPLQATMSAAT

GIQPSPVSVVGITAAVGQQPSVSSLAQPQLPYSQTAPPVQTPLPGAPPQQLQYGQQQPMVPAQIAPGHGQPVTQNPTSEYVQQQQQPIFQAALSSGQSSS

TGTGAGISVIPVAQAQGIQLPGQPTAVQTQPAGAAGQPIGQAQTAVSTVPTGGQIASIGQQANIPTAVQQPSTQVTPSVIQQGAPPSSQVVLPAPTGIIH

QGVQTRASSLPQQLVIAPQSTLVTVPPQPQGVETVAQGVVSQQLPTGSPLPSASTISVTNQVSSAAPSGMPSVPTNLVPPQNIAQPPATQNGSLVQSVSQ

SPLIATNINLPLAQQIPLSSTQFSTQSLAQAIGSQMEDARRPAEPSLGGLPQTMSGDSGGMSAVSDGSSSSLAAPASLFPLKVLPLTTPLVDGEDES - 

UNI12835 - - UNI29696 - - UNI29932 - - UNI31838 - SSGASVVAIDNKIEQAM - UNI2170 - - UNI12835 - DLVKSHL

MYAVREEVEVLKEQIKELIEKNSQLEQENNLLKTLASPEQLAQFQAQLQTGSPPATTQPQGTTQPPAQPASQGSGSTA
Transcript ENSMUST00000088906
Sequence
GCTGGCTCCGGAGTTGGCCAAAGAAG CCCTCGAAGGCACGAGCAGCCGGCGCCTTCGGCAGAGGAGGAGGAGGAGGAGGGATCGCGTCGGGCGGAGCTT

CAGGTCCTGTTCGTCTCTCCGGCTTCTCCATACAAAGATTACGGTGCAGAAGGAAATTGCACTTGCCTCCTCCGCCCCCCGGTACCCAGCACAATGCACC

AGCCGCCGGAGTCCACCGCCGCGGCGGCCGCTGCTGCAGACATTAGTGCTAGGAAGATGGCGCACCCGGCAATGTTCCCTCGAAGGGGCAGCGGTGGTGG

CAGCGCCTCTGCTCTCAATGCAGCAGGTACGGGCGTCAGTGGTGCTGCTCCATCTTCTGAAGATTTTCCTCCTCCTTCGCTGCTCCAGCCGCCGCCTCCT

GCTGCATCTTCCACGCAGGGACCCCAGCCTCCGCCTCCACAAAGCCTGAACCTCCTCTCGCAGGCTCAGCTGCAGGGACAGCCTCTTGCGCCAGGCGGAA

CTCAGATGAAAAAGAAAAGTGGCTTCCAGATAACTAGCGTTACTCCGGCTCAGATCTCTGCCAGCATCAGCTCCAACAACAGCATCGCGGAGGACACCGA

GAGCTACGACGATCTGGATGAGTCGCACACGGAAGATCTCTCCTCTTCCGAGATCCTCGACGTCTCCCTTTCCAGGGCCACTGACTTAGGTGAGCCTGAA

CGAAGCTCCTCAGAGGAGACTCTGAATAACTTCCAGGAAGCTGAGACACCTGGGGCAGTCTCTCCTAACCAGCCCCACCTTCCTCAGCCTCATTTGCCTC

ACCTTCCACAACAGAACGTTGTGATCAATGGGAATGCCCATCCCCACCACCTCCATCATCACCATCACCCTCATCATGGGCACCACCTTCACCATGGGCA

CCATCATTCATCACATGCTGCTGTGGCCGGTCCATCCATTCCCGGAGGGCCACCCTCGAGCCCAGTGTCCAGGAAACTCTCTACAACTGGAAGTTCTGAT

GGTGGTGTGCCAGTCGCACCTCCTCCTGCAGTACCATCGAGTGGCTTACCAGCATCAGTGATGACGAACATCCGTACTCCAAGTACTACAGGAAGCCTAG

 CTGCAGGTATCACTGTGGGAGTGGTTTCCAGTCAGCAGCAGCAGCAGCAGCAGCAGCAACCAACAGTTAACACATCGAGGTTCAGGGTTGTGAAGTTAG

ACTCTACTTCTGAACCCTTTAAAAAAGGTCGATGGACTTGCACAGAATTCTATGAGAAGGAAAACGCTGTGCCAGCTACAGAAGGCGTGGCCGTCAATAA

AGTGGTGGAGACGGTGAAGCAAACCCCCACGGAAGCATCGTCCTCGGAGAGGGAGAGCACTAGTGGGAGTTCTGTGAGCAGTAGTGTGAGCACACTGAGT

CACTACACGGAGAGTGTGGGAAGTGGAGAGATGATGGGAGCCCCGGCTGTGGTGGCGCCGCAGCAGCCGCCGCTACCACCAGCGCCTCCAGGTCTTCAAG

GTGTGGCTCTCCAACAGCTAGAGTTCAGTAGCCCTGCTCCACAGAGTATTGCGGCGGTTAGTATGCCACAGAGTATTTCTCAGTCACAGATGTCACAAGT

ACAGTTACAGCCTCAAGAGTTGAGCTTTCAGCAGAAGCAGACTCTTCAGCCTGTCCCTCTGCAAGCCACCATGAGTGCCGCAACTGGTATCCAGCCTTCC

CCTGTCAGCGTGGTCGGCATCACGGCGGCTGTAGGTCAGCAGCCTTCTGTTTCCAGCCTGGCTCAACCGCAGCTGCCATATTCTCAGACAGCTCCTCCCG

TGCAAACTCCTCTTCCAGGGGCACCACCCCAGCAGTTACAATATGGGCAGCAGCAACCAATGGTTCCTGCGCAGATAGCCCCAGGCCATGGCCAGCCAGT

GACTCAAAATCCAACTTCAGAGTATGTGCAGCAGCAGCAGCAGCCAATATTTCAAGCAGCATTGTCCTCTGGGCAGTCCAGTTCCACGGGCACGGGGGCA

GGAATATCAGTGATTCCTGTGGCTCAGGCACAGGGGATCCAGCTGCCAGGGCAGCCCACAGCAGTACAAACACAACCTGCAGGGGCGGCTGGGCAGCCCA

TTGGCCAGGCTCAAACAGCAGTGTCCACTGTACCAACTGGCGGTCAGATTGCAAGTATCGGTCAACAGGCAAACATACCCACTGCAGTACAGCAGCCCTC

TACCCAAGTTACACCTTCAGTTATTCAGCAAGGTGCTCCTCCATCTTCACAAGTAGTCCTACCTGCTCCAACCGGGATCATTCATCAGGGAGTTCAAACC

CGTGCTTCAAGCCTTCCACAACAATTGGTCATTGCACCCCAGAGTACCTTGGTAACTGTGCCTCCCCAGCCACAGGGAGTAGAAACCGTGGCCCAAGGGG

TTGTTTCCCAGCAGTTGCCCACAGGCAGTCCTCTGCCCTCTGCTAGCACTATTTCTGTTACAAATCAGGTTAGTTCAGCCGCTCCTTCTGGAATGCCTTC

TGTCCCAACAAACTTAGTTCCACCACAGAATATAGCACAACCCCCAGCCACCCAAAATGGCAGTTTGGTTCAAAGTGTTAGTCAATCTCCCTTGATAGCC

ACTAACATAAATTTGCCTTTGGCACAACAGATACCACTAAGTTCTACTCAGTTCTCTACACAATCATTAGCTCAGGCCATTGGAAGCCAAATGGAAGATG

CCAGGCGCCCAGCGGAGCCCTCCTTAGGCGGCTTACCTCAGACTATGAGTGGTGACAGTGGGGGAATGTCAGCAGTTTCAGATGGGAGTAGCAGCAGCCT

AGCAGCCCCTGCTTCTCTCTTCCCGTTGAAGGTGCTACCGCTGACAACACCCCTGGTGGATGGCGAGGACGAGAG - UNI12835 - - UNI29696 

- - UNI29932 - - UNI31838 - CTCTGGTGCAAGTGTGGTAGCTATCGACAACAAAATAGAGCAAGCTATG - UNI2170 - - UNI12835

 - GATCTGGTGAAAAGCCATTTGATGTATGCGGTGAGGGAGGAAGTGGAAGTTCTGAAGGAGCAGATCAAAGAACTAATAGAGAAAAACTCCCAGCTGG

AGCAGGAGAACAATCTGCTGAAGACGCTGGCCAGTCCGGAGCAGCTCGCCCAGTTTCAGGCCCAGCTGCAGACTGGCTCCCCTCCGGCCACCACGCAGCC

ACAGGGGACCACACAGCCCCCTGCACAGCCAGCATCCCAGGGCTCAGGATCAACCGCATAGCCTCCTAGGCCCCAACAGAACTGGCTGCTGCTGCTGCTG

TCTGAACTGAACAGACCGAAGAGATGTGCTAGAGAGAAGCCGCCTCCACAGTCACCCATTTCATTGCTGTCTACGAAAGAGACGTGAGACTCACACGCTG

TTCTCGCTTTCTCCCCAGTATTAAGCACTCATAAGCTTTTGGCTTGAAGAAATGTACTAGTTGAGTGAATTAAAGGTTAATCAGAGAGTGAGCAGGGATG

TGCCCTGTGCAACGTGGCAGATGTCTGAGGAATGGTTTAATTGACCCCGAGGAGCTCTGTGCCTTTTCAACCCTCCCCAGCCGCCCACCCTGCTTCTGAG

AGCTCGGGCGGCTCGCCTTCGTGGGGCTCGCCTGCGTGGGGTTCGGAAAGTGGGCTGCTCCTGGATTCTGCGCTCTCTTCTCCTTCCCTTCAAAGAACTC

GGAGAGGCCAGAAACAAGACTGCAATGGGGGGCGGGGGGAGGGATGATGCAGTCCTTATACAAAACCGACAACTGTCACCAAAGCTTATAAAACACGATA

GTACTGTCCCTCTTTTCTGAACCATCAGAAGACACAAAACTGTTAGTGACACAACGGTGACAGGTAGCTGGGACCTAGGCTATCTTATTATGAAGGTTGT

TTTGCTTGTTGTATATTTGTGTATGTAGTGTAACGAATTTGTACCATAGAGGACTGTCCGTAACTACTGTTTAGCTTCTACACATTGAAATGTAGATGTT

TCATTGGCTGTCTGAAAAGGTGTGGCTTGTCCTTCCTAGAGAGATCTACTTAAAAACTGCTTTGTGACAAAAACCACACCTGAAGAAATTTTAAGAATTT

GGCCCAGTTAGTCACTCTGTGTAATCCCGGAATCTAGCTGCTGAAGTCTTGCGAAGTAAACTCCCCGTGACCGATGTCAGTTAAGCTGGTGATACCTGGA

GAAGTGGTCAGTTGCTAAGGAAGTGGATTTCCCAGTAGGGGTTTCTGCACCTCACCTGTATAGTCGTTCTGCGCATGTCCCCCACACAGTCCCCACTGTA

TTTACCTGTTCTACTTGTCACCTTTCAATAAAGCATATCAAATGTTGAT
Translation
AGSGVGQRS SPRRHEQPAPSAEEEEEEGSRRAELQVLFVSPASPYKDYGAEGNCTCLLRPPVPSTMHQPPESTAAAAAAADISARKMAHPAMFPRRGSG

GGSASALNAAGTGVSGAAPSSEDFPPPSLLQPPPPAASSTQGPQPPPPQSLNLLSQAQLQGQPLAPGGTQMKKKSGFQITSVTPAQISASISSNNSIAED

TESYDDLDESHTEDLSSSEILDVSLSRATDLGEPERSSSEETLNNFQEAETPGAVSPNQPHLPQPHLPHLPQQNVVINGNAHPHHLHHHHHPHHGHHLHH

GHHHSSHAAVAGPSIPGGPPSSPVSRKLSTTGSSDGGVPVAPPPAVPSSGLPASVMTNIRTPSTTGSLA AAGITVGVVSSQQQQQQQQQPTVNTSRFRV

VKLDSTSEPFKKGRWTCTEFYEKENAVPATEGVAVNKVVETVKQTPTEASSSERESTSGSSVSSSVSTLSHYTESVGSGEMMGAPAVVAPQQPPLPPAPP

GLQGVALQQLEFSSPAPQSIAAVSMPQSISQSQMSQVQLQPQELSFQQKQTLQPVPLQATMSAATGIQPSPVSVVGITAAVGQQPSVSSLAQPQLPYSQT

APPVQTPLPGAPPQQLQYGQQQPMVPAQIAPGHGQPVTQNPTSEYVQQQQQPIFQAALSSGQSSSTGTGAGISVIPVAQAQGIQLPGQPTAVQTQPAGAA

GQPIGQAQTAVSTVPTGGQIASIGQQANIPTAVQQPSTQVTPSVIQQGAPPSSQVVLPAPTGIIHQGVQTRASSLPQQLVIAPQSTLVTVPPQPQGVETV

AQGVVSQQLPTGSPLPSASTISVTNQVSSAAPSGMPSVPTNLVPPQNIAQPPATQNGSLVQSVSQSPLIATNINLPLAQQIPLSSTQFSTQSLAQAIGSQ

MEDARRPAEPSLGGLPQTMSGDSGGMSAVSDGSSSSLAAPASLFPLKVLPLTTPLVDGEDES - UNI12835 - - UNI29696 - - UNI29932 

- - UNI31838 - SSGASVVAIDNKIEQAM - UNI2170 - - UNI12835 - DLVKSHLMYAVREEVEVLKEQIKELIEKNSQLEQENNLLKTL

ASPEQLAQFQAQLQTGSPPATTQPQGTTQPPAQPASQGSGSTA

For any suggestions or comments, please send an email to unitrap@crg.es