Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000022025 (Lect1)
Chromosomal location
Chr 14: 80037501 - 80061977 (-)
Description
leukocyte cell derived chemotaxin 1 Gene [Source:MGI Symbol;Acc:MGI:1341171]
Human Ortholog
not available
Omim not available
UniTrap UNI38572
Vector Insertion
Chr 14: 80045169 - 80050230
Public Clones (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 47% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000022603
Sequence
CAGAAGGGCTGGCCAGAGCAGGACGCTGCTGTTGCTGCTGCTGCTGCTCCTGCTGCTGCTGTTGTACAGGGGGCATTCGTTGTAGGGACAAGAGGACAGT

TGGAACAGTTAGGACAGTGGGATAGGGTCTTCGCGTATCTTACTTCTCCATCTTCAGCCATGACAGAGAACTCAGACAAAGTTCCTATCACCATGGTAGG

GCCTGAGGACGTTGAGTTTTGCAGTCCCCCG GCGTACACCACCGTCACCGTGAAGCCCTCCGGGAGCCCAACACGGCTGCTCAAGGTAGGAGCTGTGGT

CCTCATTTCTGGCGCGGTACTGCTGCTCTTCGGGGCCATCGGGGCCTTCTACTTCTGGAAGGGGAATGACAATCAC ATTTACAATGTTCATTACAGTAT

GAGTATCAATGGGAAACTACAAGATGGGTCAATGGAAATAGATGCTGTGAACAACTTGGAGACCTTTAAAATGGGAAGCGGAGCGGAAGAAGCAATTGAA

GTCAACGATTTTAAAAAT - UNI38572 - GGCATCACTGGGATCCGTTTTGCTGGAGGAGAGAAGTGCTACATCAAAGCACAGGTGAAGGCTCGCAT

CCCTGAGGTGGGCACAGTGACCAAGCAGAGCATCTCTGAACTG - UNI38572 - GAAGGCAAGATCATGCCAGCTAACTACGAAGAGAACTCGCTGA

TTTGGGTGGCCGTGGACCAGCCTGTGAAGGACAGCAGCTTCTTGAGCTCTAAAATCCTTGAACTCTGTGGCGACCTGCCGATTTTCTGGCTTAAGCCCAT

GTATCCAAAAG - UNI38572 - AAATCCAGAGAGAGAGAAGAGAAGTCGTGAGAAACAGTGCTCCCTCTACCACAAGAAGACCACACAGCGAACCTC

GAGGTAACGCAGGCCCTGGAAGACTGAGTAACGGAACCAGACCCAATGTTCAGGACGACGCAGAACCTTTCAACCCTGACAATCCTTACCAC CAGCAGG

AAGGAGAAAGCATGACATTTGACCCTAGACTGGACCATGAAGGGATCTGCTGTATAGAATGCAGGCGGAGCTACACCCACTGCCAGAAGATCTGTGAACC

ACTGGGAGGCTACTATCCATGGCCTTACAATTACCAAGGATGCCGCTCGGCCTGCAGAGTCGTCATGCCATGCAGCTGGTGGGTGGCCCGCATCTTGGGC

ATGGTGTAAATCCAGTTCATCTATCAGGACTGCCAAGCAAGAATCGATATGAGAGTTGAGAACCAAAGAAGCATAGAGCATGTCCATGCCAAGAGACCAC

AAAGTATTTTATATTCAACCTGAATAATGTTATCCTAAACGCTGTTGTGCACCACTGTGTGCAAATGTGCTGAAAGGGTAGTTTAACTCTACAATTATTA

TCATTTTACGACTTGCTTTACCAATAAAGCCTACTGCAAGTCTTTAAAAGCTACTTTTGAAATAAATATGAAAACTT
Translation
MTENSDKVPITMVGPEDVEFCSPP AYTTVTVKPSGSPTRLLKVGAVVLISGAVLLLFGAIGAFYFWKGNDNH IYNVHYSMSINGKLQDGSMEIDAVNN

LETFKMGSGAEEAIEVNDFKN - UNI38572 - GITGIRFAGGEKCYIKAQVKARIPEVGTVTKQSISEL - UNI38572 - EGKIMPANYEENSL

IWVAVDQPVKDSSFLSSKILELCGDLPIFWLKPMYPKE - UNI38572 - EIQRERREVVRNSAPSTTRRPHSEPRGNAGPGRLSNGTRPNVQDDAEP

FNPDNPYH QQEGESMTFDPRLDHEGICCIECRRSYTHCQKICEPLGGYYPWPYNYQGCRSACRVVMPCSWWVARILGMV

For any suggestions or comments, please send an email to unitrap@crg.es