Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000022037 (Clu)
Chromosomal location
Chr 14: 66587491 - 66600384 (+)
Description
clusterin Gene [Source:MGI Symbol;Acc:MGI:88423]
RefSeq_dna
NM_013492 
RefSeq_peptide
NP_038520.1 
MGI
MGI:88423 
Uniprot/SWISSPROT
Q06890 
Uniprot/SPTREMBL
Q3V245 Q549A5 Q9JK98 
Human Ortholog
ENSG00000120885 (CLU)
Omim not available
UniTrap UNI23229
Vector Insertion
Chr 14: 66587526 - 66590568
Public Clones not available
Private Clones OST269992 (lexicon) OST62924 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000022616
Sequence
CCAGGAGGAGCGCACTGGAGCCAAGCCGCAGACCG - UNI23229 - GACTCCAGATTCCAAGGAGGCCACGCCATGAAGATTCTCCTGCTGTGCGTG

GCACTGCTGCTGATCTGGGACAATGGCATGGTCCTGGGAGAGCAGGAGGTCTCTGACAATGAGCTCCAAG AACTGTCCACTCAAGGGAGTAGGTATATT

AATAAGGAGATTCAGAACGCCGTCCAGGGAGTGAAGCACATAAAAACTCTCATAGAAAAAACCAACGCAGAGCGCAAGTCCTTGCTCAACAGTTTAGAGG

AAGCCAAGAAGAAGAAAGAG GATGCTCTGGAGGACACTAGGGATTCTGAAATGAAGCTGAAGGCATTCCCGGAAGTGTGTAACGAGACCATGATGGCCC

TCTGGGAGGAGTGCAAGCCCTGCCTGAAGCATACCTGCATGAAGTTCTATGCACGTGTCTGCAGGAGCGGCTCAGGGCTGGTCGGCCAGCAG CTAGAGG

AGTTTCTAAACCAGAGCTCACCCTTCTACTTCTGGATGAACGGCGACCGCATCGACTCCCTGCTGGAGAGTGACCGGCAGCAGAGCCAAGTCCTGGATGC

CATGCAGGACAGCTTTGCTCGGGCATCTGGCATCATAGACACGCTCTTTCAGGACCGGTTCTTCGCCCGTGAGCTTCATGACCCCCACTACTTCTCCCCC

ATCGGCTTCCCACACAAGAGGCCTCATTTCTTATATCCCAAGTCCCGCTTGGTCCGCAGCCTCATGTCTCCCTCCCACTATGGGCCTCCGAGCTTCCACA

ACATGTTCCAGCCTTTCTTTGAGATGATCCACCAGGCTCAACAGGCCATGGATGTCCAGCTCCACAGCCCAGCCTTCCAGTTCCCAGACGTGGATTTCTT

AAGAG AAGGTGAAGATGACCGCACTGTGTGCAAGGAGATCCGCCGCAACTCCACAGGATGCCTGAAGATGAAGGGCCAGTGTGAAAAGTGCCAGGAGAT

CTTGTCTGTGG ACTGTTCAACCAACAATCCTGCCCAGGCTAACCTGCGCCAGGAGCTGAACGACTCGCTCCAGGTGGCCGAGAGGCTGACAGAGCAGTA

CAAGGAGCTGCTGCAGTCCTTCCAGTCGAAGATGCTCAACACCTCATCCCTGCTGGAGCAGCTGAACGACCAGTTCAACTGGGTGTCCCAGCTGGCTAAC

CTCACACAGGGCGAAGACAAGTACTACCTTCGGGTCTCCACC GTGACCACCCATTCCTCTGACTCAGAGGTCCCCTCCCGTGTCACTGAGGTGGTGGTG

AAGCTGTTTGACTCTGACCCCATCACAGTGGTGTTACCAGAAGAAGTCTCTAAGGATAACCCTAAGTTTATGGACACAGTGGCGGAGAAGGCGCTACAGG

AATACCGCAGGAAAAGCCG TGCGGAATGAGATAGAAGCATCACCTTCCTATATGTAGGAGTGTCTGGGAGGGAATCTCCCAGCTCCCCGAGGTGGCTGC

AGACCCCTAGAGAACTCCACATGTCTCCAGGCGAGTAGGCCTCACCCAAGCAGCCTGCCCTTCCTCTGGATTCTGTACACTAATGCCTGCACTTGCTGCT

CTCGGGAAGAACTGATTCCCCCACGCAACTAATCCAATAAAAGCCGCCTTGCGATACGTG
Translation
 - UNI23229 - MKILLLCVALLLIWDNGMVLGEQEVSDNELQE ELSTQGSRYINKEIQNAVQGVKHIKTLIEKTNAERKSLLNSLEEAKKKKE DA

LEDTRDSEMKLKAFPEVCNETMMALWEECKPCLKHTCMKFYARVCRSGSGLVGQQ LEEFLNQSSPFYFWMNGDRIDSLLESDRQQSQVLDAMQDSFARA

SGIIDTLFQDRFFARELHDPHYFSPIGFPHKRPHFLYPKSRLVRSLMSPSHYGPPSFHNMFQPFFEMIHQAQQAMDVQLHSPAFQFPDVDFLRE EGEDD

RTVCKEIRRNSTGCLKMKGQCEKCQEILSVD DCSTNNPAQANLRQELNDSLQVAERLTEQYKELLQSFQSKMLNTSSLLEQLNDQFNWVSQLANLTQGE

DKYYLRVST VTTHSSDSEVPSRVTEVVVKLFDSDPITVVLPEEVSKDNPKFMDTVAEKALQEYRRKSR RAE

For any suggestions or comments, please send an email to unitrap@crg.es