Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000022074 (Tnfrsf10b)
Chromosomal location
Chr 14: 70167336 - 70184210 (+)
Description
tumor necrosis factor receptor superfamily, member 10b Gene [Source:MGI Symbol;Acc:MGI:1341090]
RefSeq_dna
NM_020275 
RefSeq_peptide
NP_064671.2 
MGI
MGI:1341090 
Uniprot/SWISSPROT
Q9QZM4 
Uniprot/SPTREMBL
Q6GSD9 
Human Ortholog
ENSG00000173535 (TNFRSF10C)
Omim 275355 - SQUAMOUS CELL CARCINOMA, HEAD AND NECK  
UniTrap UNI37621
Vector Insertion
Chr 14: 70173295 - 70174892
Public Clones (cmhd)
Private Clones not available
Severity of mutation (?) Insertion after 30% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI33975
Vector Insertion
Chr 14: 70176076 - 70177527
Public Clones CMHD-GT_460F2-3 (cmhd) IST14396D9 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 57% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI18480
Vector Insertion
Chr 14: 70177623 - 70180310
Public Clones IST12639G9 (tigm)
Private Clones OST422688 (lexicon)
Severity of mutation (?) Insertion after 65% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI13590
Vector Insertion
Chr 14: 70180381 - 70182038
Public Clones CMHD-GT_309G07-3 (cmhd) CMHD-GT_311F04-3 (cmhd) PST224-1 (escells) PST5759-NR (escells)
PST2098-NR (escells) PST15354-NR (escells)
Private Clones not available
Severity of mutation (?) Insertion after 71% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000022663
Sequence
GTCGCCGCGACAAGAATCCAGAACTTTTCTGGGAGTGAGGAAATCCAGAGAACTTTTTTAGGAGTGAGGGGACAGCCATCCTTCGTGGCTTTTGGGAGCT

GAAGCCGCAGGGTTTCGGATGAGCTGACACCATGGAGCCTCCAGGACCCAGCACGCCCACAGCCTCTGCCGCTGCCCGGGCAGATCACTACACCCCAGGC

CTCCGGCCACTCCCGAAGCGCAGACTTCTATATAGCTTTGCGTTGCTGCTTGCTGTGCTACAG GCTGTCTTTGTTCCAGTAACAGCTAACCCAGCCCAT

AATCGTCCAGCTGGCCTACAGCGGCCGGAGGAGAGCCCATCAAGAGGACCCTGTCTAGCAG GCCAGTACCTGTCAGAAGGGAACTGCAAGCCTTGCAGA

GAGGGTATTGACTACACCAGCCATTCCAACCATTCTCTGGATTCATGTATTCTCTGCACAGTCTGTAAGGAAG ATAAAGTCGTAGAAACCCGATGCAAC

ATAACCACAAATACGGTGTGTCGATGCAAACCAGGCACCTTTGAAGATAAAGACTCCCCTGAGATCTGCCAGTCATGCTCTAA CTGCACTGACGGGGAA

GAGGAACTGACTTCCTGTACCCCCAGAGAAAACCGGAAGTGTGTCTCCAAAACGGCTTGGGCATCTTGGCATAAGCTAGGCCTCTGGATAGGACTCCTGG

TTCCAGTAGTGCTGCTGATTGGAGCTCTGCTTGTCTGGAAGACTGGAGCATGGAGGCAATGGTTGCTCTGTATAAAAAGAG - UNI33975 - GCTGT

GAACGGGATCCCGAAAGTGCGAACTCTGTGCATTCGTCTCTCTTGGACCGACAGACATCTAGCACGACAAATGACTCTAACCACAACACG - UNI1848

0 - GAACCTGGCAAGACTCAGAAAACAGGAAAGAAGTTGCTGGTTCCGGTAAACGGAAACGACTCAGCTGACG - UNI13590 - ACCTGAAGTTTA

TCTTCGAGTATTGTTCGGACATAGTGCCCTTTGACTCCTGGAACCGTCTCATGCGGCAGTTGGGCCTCACAGACAATCAAATCCAAATGGTCAAAGCCGA

AACACTGGTCACACGTGAGGCCCTGTACCAAATGCTGCTCAAGTGGCGCCACCAGACTGGGCGAAGTGCCTCCATCAACCATCTGCTGGATGCCTTGGAA

GCCGTGGAAGAGAGAGATGCCATGGAGAAAATTGAAGACTACGCAGTGAAATCCGGGAGGTTTACTTATCAGAACGCTGCAGCCCAACCAGAGACAGGGC

CAGGAGGATCTCAGTGCGTTTGAAGTCAGCCTGATCTACTTAGTGAACTCAGGACAGCCAAGGCTATGTAGAGAGCCCCGAAGATGCAGGCTCTTCAGTA

TTATGAGAATGTACTTAATTTTTTCTTGTAGTAGTTAGTGTATCATATTATTGTATTATTTATATTATTACTGTTAAGTACTATGTTCTCTTATTAGAAG

TTGAACACAGAACCTCTGAGAACACATATGCTACAAGTGTTCTAACACACCTCCAGCATCCCGGATTACCTTTGTTCCTGAACAAGGCACAATTGGTAGG

GTATGATAGGGCCTGCCTATCATCCTAACACTCCGGTGATGGAGCCAGGAAGATCAAGAGTTCGAGGCCAGCTGGTTCACATAAGATCCCATATAATGTG

CAGGATGGCTAAACTTGCTGAGAGCTGACTCTGTGGTCTCCTGTCCCAGATTCTAGCGATATTCATTACTAAGACCCTTGTCCAGAGACAAAAGACCACC

TCTGTAACAGAGGGAAGAATAAAACAGCCCTAGGGTGGAAACTCCTTGTGAACACAGCCACTGCTGTTTACTGTTAGACTACTGCTCAGCACTACACAGC

TGCACGGCACCTCCCTGTGCCAGGTGCTAGTGGGCAGCCTACTGAGGGTACATCTAACTTGAATCTAACACACTTGAAGTGAGTTTGCTGGTTTGGACAC

AGAGGGAGCATTAAGTGCTACCTGGGGTGACCCTTGAGGACCACGCCCCCTGTAAGCATTTGACCATTGTGAGAGTAAACACTGAAACTCACCATTGTCC

TGCCTCAGCCTTTCTAGAGCTGGAATCATAGGTATGCTGCACCGGATCCAGAAGGAGAAATAACTACCTTTAGATACTGTGATAGGGATTTCTAGAAAGC

TGCCACATACAGATTTTTGTCCTGTGTGAATTCCTATTGTTTTTTGTTTGTTTTTAATTTTTTATTATTTATTTTCTTCATTCACATTTCAAATGCTATC

CCAAAAGTCCCCTATGCCCTCCCCCCCCCTGCCCCCCGCCCTGCTCCCCTACCCACTCACTCACTCCCACTTTTTTTTTTTTTTTTGAGACAGGGTTTCT

CTGTGTAGCCCTGGCTGTCCTGGAACTCACTCTGTAGACCAGGCTGGCCTCGAACTCAGAAATTCACCTGCCTCTGCCTCCCAAGTGCTGGGATTAAAGG

TGTGTGCCACCATGCCCGGCCTTTTTTTTTTTTTTTTAATTAGGTATTTATTTCATTTAAATTTCCAATGCTATCCCAAAAGTCCCCCACATGCTCCCCC

ACCCACTCCCCACCTGACTTTATATGCCTCACTCCCACTTCTTGGCCCTGGTGTTCCCCTGTACTGGGGCATATAACGTTTGCAAGACCAAGGGGCGTCT

CTTTCCACTGATGGCCGACTAGGCCATCTTCTGATACATATGCAGCTAGAGACACGAGCTCTGGGGGGGTACTGGTTAGTTCATATTGTTGTTCCACCTA

TAGGGTTGCCGACCCCTTCAGCTCCTTGGGTACTTTCTCTAGCTCCTCCACTAGGGGCCCTGTGTTCTATCCAATAGATGACTGTGAGCATCCACTTCTG

TATTTGCCAGGCACTGGCATAGCCTCATACGAGACAGCTATATCAGGGTCCAGTTTTGTTTTGTTTTGTTTTAAACTAGCATGCTGGAGAGGTAGCTCAG

CGGTTAAGAGCAGTGGCTGCTCTTCCAGAGGTCCTGAGTTCCAATTCCCAGCAGCTACATAGTGGCTCACAACCTTCTCTAATGGGATCTGATGTCCTTT

TCTAGTGTGTTTGAAGCCAGTGGCAGTGTAATTACATACACAAAATAAATAAATCTTTTT
Translation
MEPPGPSTPTASAAARADHYTPGLRPLPKRRLLYSFALLLAVLQ AVFVPVTANPAHNRPAGLQRPEESPSRGPCLAG GQYLSEGNCKPCREGIDYTSH

SNHSLDSCILCTVCKED DKVVETRCNITTNTVCRCKPGTFEDKDSPEICQSCSN NCTDGEEELTSCTPRENRKCVSKTAWASWHKLGLWIGLLVPVVL

LIGALLVWKTGAWRQWLLCIKRG - UNI33975 - GCERDPESANSVHSSLLDRQTSSTTNDSNHNT - UNI18480 - EPGKTQKTGKKLLVPVN

GNDSADD - UNI13590 - DLKFIFEYCSDIVPFDSWNRLMRQLGLTDNQIQMVKAETLVTREALYQMLLKWRHQTGRSASINHLLDALEAVEERDAM

EKIEDYAVKSGRFTYQNAAAQPETGPGGSQCV

For any suggestions or comments, please send an email to unitrap@crg.es