Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000022075 (Rhobtb2)
Chromosomal location
Chr 14: 70184799 - 70205277 (-)
Description
Rho-related BTB domain containing 2 Gene [Source:MGI Symbol;Acc:MGI:2180557]
RefSeq_dna
NM_153514 
RefSeq_peptide
NP_705734.4 
UniGene
Mm.397418 
MGI
MGI:2180557 
Uniprot/SWISSPROT
Q91V93 
Uniprot/SPTREMBL
Q80TT6 Q8BV20 Q8BYU3 
Human Ortholog
ENSG00000008853 (RHOBTB2)
Omim not available
UniTrap UNI31484
Vector Insertion
Chr 14: 70200424 - 70205278
Public Clones IST13036B4 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000022665
Sequence
GCGCGCGTGCGGCGGCCTCACCCGGCGCCTCGCTCTCTAGCGCGCCGCCCGCAACCTCCGCAGCGCAGCCGGGCGGCGGCGCGGCCCAGCGGCCGGAGGT

CGGAGCGGCGGCGCGCAACCCGGCTCCGCGAGCCTCCATGACATTGGGCGCCCGGGTCGCGCGGAGATGCTGATCCGGAAGAGGCAGTGGCTGCAGTGCA

GCGCCCCAGGCTGCTCACGTGCCGCGGTCCGACCAGGGCTCCTGTGCCAGAGTTTCTTCTGATCGTACCTGAACCGGGACCCCAGGAGTCTGGGTCTCCA

GCACAGAGCAGCAGCGTCGGCGGCGCCCCAACTTGCACGCGCAGAGTGACCCCAGACATCTCACTAAAATGAGCGTGCTTAGCAGGAAGAGATGTGTTCC

CTACACTAGAAATTACCCCGTCACATGTAGTGGT - UNI31484 - GTCCCAATTAATGGATTCTGACATGGATTATGAAAGGCCAAACGTAGAGACC

ATCAAGTGCGTGGTGGTGGGGGACAACGCCGTGGGCAAGACTAGGCTCATCTGTGCCCGGGCCTGCAATGCCACCCTCACCCAGTACCAGTTGCTTGCCA

CCCATGTGCCCACAGTGTGGGCCATTGACCAGTATCGTGTGTGCCAGGAG - UNI31484 - GTGCTAGAACGCTCCCGAGATGTGGTAGATGACGTC

AGCGTCTCCCTGCGCCTCTGGGACACCTTCGGAGACCACCACAAAGACCGGCGTTTTGCTTATGGAAG ATCCGACGTGGTGGTTTTGTGTTTCTCCATC

GCCAACCCCAATTCCCTCCACCATGTCAAGACCATGTGGTACCCAGAAATCAAGCATTTCTGCCCCAGAGCTCCTGTCATTCTGGTGGGCTGCCAGCTGG

ACCTGCGCTATGCTGACCTGGAAGCCGTTAACAGGGCCAGGAGACCTCTGGCTAG GCCCATCAAGCCCAATGAAATCCTCCCCCCAGAGAAGGGTCGGG

AAGTCGCCAAAGAGCTGGGGATCCCTTACTACGAGACCAGTGTGGTGGCCCAGTTTGGTATCAAGGACGTCTTTGACAATGCCATTCGGGCTGCGCTCAT

CTCCCGCCGCCACCTGCAGTTCTGGAAATCACATCTGCGCAATGTGCAGCGGCCTCTACTGCAAGCACCCTTCCTCCCCCCCAAGCCACCGCCCCCCATC

ATCGTGGTGCCCGATCCCCCCTCCAGCAGCGAGGAGTGCCCCGCCCACCTCCTGGAAGACCCGCTCTGTGCGGATGTCATCCTGGTGCTGCAGGAGCGCG

TGCGCATCTTTGCCCACAAAATCTACCTCTCCACCTCCTCCTCCAAATTCTATGACTTATTCCTCATGGACCTGAGTGAGGGGGAGCTGGGGGGCCCCTC

AGGGTCAGGGGGGCCCCGCCCAGAGGACCACCGGAGCCACCCTGAACAACACCACCATCATCACCATCACCACCATGGGCGGGACTTCCTGCTTCGGGCA

GCCAGCTTTGACGTATGTGAGAGTGTGGATGAGGCCGGCGGCTCTGGTCCGGCTGGCCTAAGGGCTTCAACCAGTGACGGGATCTTACGGGGTAATGGAA

CAGGGTACCTGCCAGGCAGAGGACGTGTGCTGTCTTCCTGGAGCCGAGCTTTTGTGAGTATCCAGGAAGAGATGGCAGAGGATCCTCTGACCTTCAAATC

CCGGCTGATGGTGGTGGTGAAGATGGATAACTCCATTCAGCCGGGGCCCTTCCGGGCTGTTCTCAAGTACCTGTACACAGGGGAGCTAGGTGAGAATGAG

CGGGACCTCATGCACATTGCTCACATTGCCGAGCTGCTAGAGGTCTTTGATCTACGAATGATGGTGGCCAACATTCTCAACAACGAAGCCTTCATGAATC

AGGAGATCACCAAGGCCTTCCATGTACGCCGGACCAACCGGGTTAAGGAGTGTTTGGCAAAGGGCACCTTTTCAG ATGTGACCTTCATCCTGGATGATG

GGACCATCAGCGCCCATAAGCCCCTGCTGATTTCCAGCTGTGACTGGATGGCTGCCATGTTTGGGGGGCCATTTGTGGAGAGTTCTACCAGGGAG GTGG

TGTTTCCATACACAAGCAAGAGCTGCATGAGAGCTGTGTTGGAGTACCTCTATACAGGCATGTTCACCTCCAGCCCAGACCTGGATGATATGAAGCTCAT

TGTCTTGGCTAACCGCCTCTGCCTGCCGCACTTGGTTGCCCTCACAG AGCAGTACACAGTGACTGGACTGATGGAGGCGACCCAGATGATGGTGGACAT

CGATGGGGATGTCCTTGTATTCTTGGAATTGGCACAG TTCCACTGCGCGTACCAGTTGGCCGACTGGTGTCTTCACCATATCTGCACCAACTACAACAA

CGTGTGCCGCAAGTTCCCCAGAGACATGAAGGCTATGTCTCCAG AAAACCAGGAGTACTTTGAGAAACACCGGTGGCCGCCAGTCTGGTACCTGAAAGA

AGAGGACCACTATCAGCGTGCGCGGAAGGAGCGAGAGAAAGAGGACTATTTACACCTGCGGAGGCAGCCCAAGCGGCGGTGGCTGTTTTGGAACAGTCCC

TCATCACCGTCCTCCTCAGCAGCGGGCTCAGCATCCCCCTCCTCCTCCTCCTCGGCTGTGGTCTGAGATGCTGCCACCGTCTTCTGATCCCGCTGCTGTT

GTCCTCATTAGCCCTTGTCCTTCTGCTCTTCTGTATCATCCCCTCTACCCGACAGGTGACGAGGGAATTCACCTAACCAGAATCCTAAGGGCAGAGCCGT

TCTCACCAGCCAATGTGGCCCAGGCTAAGAGGAGCCAGCCCTGCAGATCAGAACAGGGTCCACCTACAATTCCAGGCAGGGCAGGAAAACATCTGCCCCA

AGGTGGGGAGCAGGAGAGAGCTCAGAGCTCGGATATTTTCTCTCTGGACTTGACAATAGAGCCAGTGGAGGAAAGCTTCCCCTGTACTCGGGCTTGTCTG

TATTGGTGTCTGCTTTGGTCAGAGGCAGCTTCCTCTCCAGGAGCTGGTCTTTTTTTTTTTCCCATCCACAGACTTTTGAGGGTTGCAAGTATTTCGTGAG

CATTGTCCCTCGGGCTTATTGAAATCCTTGAGAAGTTAAGGTAGAAAAGAAGTCTTCAGAGCCCACATCAAGTCTCCTAGGCCGTGAGGTGTGGCTGCTG

GCGGGGAGAAGAATAAACTGCAGCCTGCCAGCATCCTGTAAGGACTGACTGCAGGCAGTGTAGACTTAGTGGTGGGTAGCAGCGGTGACTCCGTGTTCAG

GTTTGTAGGCAGCACTTTAGTACAATGTGGGTTCTCTACTTCACCCTTCCCGCACACATTACATCTGACATGGATGAAGGAGGAGGAAGAGGAGGAGGAA

GGGTGGGTTCTGTGCTCAGCAGTTTTATGCTCCTCTGGGGTTTCTCCCCCTGCCTCTGGGCAGCACTGCCTTTTATGAGATGGGAGCAAAAACAGCCTAA

CAGGAGAAACCCAAACTCAAAAGCACCACCAAGACCATGTTATCCTTCATCTCCCCAAAAGAATGAAGTTCTAAAAAGAGAGACCCTGTAGGGTGTACAT

CTTCATAAGGCTGAATGGAGGCCTCTATTATTATGTGGCTATGAAGGGTCAGTAGTACCAACCACTCCAATGCCTTTCAGGGGAGGACCTGTACCCTCCG

TTTCTGAGGATGCCACTCCCCAAGGCCTGCTGGGTCTAGGCTACTGGGTTTCGGGGAAAGTGTGGGCTTCGGGGCTCAAATGGCTTTGTACCTTTTCCAC

CTTGATGCAGGATACTTTTCTCTTCCAAAGGTGACTCTACGGGATGTGCGTGGGGCAATGTGCTTCCTGGGGCGGGGGGAGGCTTTCAGCAGGAATTAAA

TGTCAAAAAAGGGAGCACTGGAGAACAGGCTACACATAGCCAACCTGGTACTGGCTGGGGATAAGGGGAAGGAGAAAACAGGGGTAGCTGAGCAGGAAGG

AAATGATGCGAGTCTAAAGAGGAATTGGGGAGACTGGAGGATTGACAACAGTGGCTGGAAGCCCCCGTGGGATTGACACTGGGTCTCAGTTGACCCTTCC

CATTTCCTAATTACGATCCACATATCACCACCTTTACCCTCTCTCTAGACTTACGAGGTGAAGTCCCATGAGGGAGTAGGTCATGAAAGTTCTGGGGTCC

CCTTCCCTGAGAAAATGCTTTAGGTAAGGAAATACTGGCTGAGTCCCCAGGACCTAGCTAGGTTGCTTAAGCTGGAATTAAAGCAACCCCAGAAACAAAT

GCAACCTACAATTGTGTGGTACCGGGACCTCGAGTTCTGATCTGGTCTTGTCAGAAGGAACAAGTAGTAGCAGGTCTCACAGTGCTGATTTTCTGTAGTC

TGAGCCTGGAACCGCCAAGCCTGCTGCTGCCTAGTAGTTAAAAGCCCTCCAGAGTTGCTGGCTGGGGAAGTGTGTTGTGTGCTGCCCTCTACTAGCTGGT

GTGCCCTGCTGCTGAATTCTAAATGGCTTCTAGTGTGGAGAAGCCTGCACTCATGGAAAAGGCAGGCAGCTTCTCACACCTTCCTTGGACGATACAGGGG

TATCTCTCTCGGGAACTGTAAATGATAGGTAGATGTCTGTCCTAATGAGCAAGGGGAATTGGGTCTCCCAAGTGATTTACAGGGCTGAGCCGCCTGGCAT

CACTGGTAATGAGGATGGACAGGCTAGTAGGAGAAAGATCTGTGGAGGTGGAGGAAGACCAAGGAGAACACCATGCCCCACCCAGGCCAGTTCACCCCTC

AGGGACCCACCCCTACCCCCACAGCTGTCAGAGCTGGTGTGCAGCAGGTGGACCCCTGTGGCCTTGTATACCCACAGTGGGGGGTGGGGCTGTGAGTGAG

CCAGGAGAGGGAGGTGCTGCTTGCAGTCCCTTAGTACATGGGTGCTCTGGATTCCAGGGAGACAAAAGCAGGAGAAACTCCAGTGTGGGACAAGTCTGGC

ATAACACCCCCAGGGGTGGGGCAGTGTCCCAAGAACATGCTCCTCTGGACTATGTCACATGTCACTCAGTGTTGTCTTAGAGGATGGGGGTAAAAACACA

AACCCACAACCCCTCTCCACACACCTTTTTATATAAGGTTTCATATTTAATTTGGTCATGAATTCATAATACATGAGTATTTTGTATCT
Translation
 - UNI31484 - MDSDMDYERPNVETIKCVVVGDNAVGKTRLICARACNATLTQYQLLATHVPTVWAIDQYRVCQE - UNI31484 - VLERSRDV

VDDVSVSLRLWDTFGDHHKDRRFAYGR RSDVVVLCFSIANPNSLHHVKTMWYPEIKHFCPRAPVILVGCQLDLRYADLEAVNRARRPLAR RPIKPNEI

LPPEKGREVAKELGIPYYETSVVAQFGIKDVFDNAIRAALISRRHLQFWKSHLRNVQRPLLQAPFLPPKPPPPIIVVPDPPSSSEECPAHLLEDPLCADV

ILVLQERVRIFAHKIYLSTSSSKFYDLFLMDLSEGELGGPSGSGGPRPEDHRSHPEQHHHHHHHHHGRDFLLRAASFDVCESVDEAGGSGPAGLRASTSD

GILRGNGTGYLPGRGRVLSSWSRAFVSIQEEMAEDPLTFKSRLMVVVKMDNSIQPGPFRAVLKYLYTGELGENERDLMHIAHIAELLEVFDLRMMVANIL

NNEAFMNQEITKAFHVRRTNRVKECLAKGTFSD DVTFILDDGTISAHKPLLISSCDWMAAMFGGPFVESSTRE VVFPYTSKSCMRAVLEYLYTGMFTS

SPDLDDMKLIVLANRLCLPHLVALTE EQYTVTGLMEATQMMVDIDGDVLVFLELAQ FHCAYQLADWCLHHICTNYNNVCRKFPRDMKAMSPE ENQEY

FEKHRWPPVWYLKEEDHYQRARKEREKEDYLHLRRQPKRRWLFWNSPSSPSSSAAGSASPSSSSSAVV

For any suggestions or comments, please send an email to unitrap@crg.es