Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000022076 (Klhl1)
Chromosomal location
Chr 14: 96504485 - 96918253 (-)
Description
kelch-like 1 (Drosophila) Gene [Source:MGI (curated);Acc:Klhl1-001]
RefSeq_dna
NM_053105 
RefSeq_peptide
NP_444335.2 
UniGene
Mm.308735 
MGI
MGI:2136335 
Uniprot/SWISSPROT
Q9JI74 
Uniprot/SPTREMBL
Q3TQM4 Q505E9 Q5DTX3 Q8CCY1 Q9JI73 
Human Ortholog
ENSG00000150361 (KLHL1)
Omim not available
UniTrap UNI33290
Vector Insertion
Chr 14: 96745988 - 96767894
Public Clones IST10218D11 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 37% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000022666
Sequence
GTTTTTTCCCGGGATATTTATTTTTCTCCTTTACAAACTGACTATATAAAACCGCCCCTTTTCTCATCTCAGAAAGCATTTGACTGTCCTTCGGACACCT

GGCAAGCTATCAGGGAATTATCCCAGAGGACAGGGACAGGGAGCAGGTGCACAGACCCGCCTAAGGGTTGGGGGGTGCACTACTTCTCGACTTGAGGCTC

TTTTTCTCTGCACTCATCAAACACGGAACTCTGAGCTGCGAAGACAGGAGATCTGAATAGCTTCCAAACCACAGCTCGGCACCGAGTGTGTATCAGTGTG

GCGGAGCCAGCTGCTGCCACCTCTGGAGCTGAGGAGAGCTCAAACCTCTCTCCCTTCCTCTTGCATTTCCAGCCTCTCTTTCCTCCGGGGGGGTCACCAC

GGGGGTCCCCGCAAGCTCCTCGTGGATTCTAAGCCCCTGGTATCCCAAGACGTCATTCGATCTAGACCGGAGCTTCCCCAAAGCTCAGATCCCAGCAAAA

GGACCCAGACTGAGCCGCGAGGCTCTGCAGAGCGCTCAAGGTGCCGGTGTGGTCTCCTGGTGAGACGCACAGCCCCTTTTAAGCCACCTTTGGCACTCCG

TGTACACCGGGTGAATCCTGCCTCCTCCTCTCTCTCCAGAAGCCACTGGCCACCCCAGTACGCTCGCCAGGCTACTGGTGTGTGAGCTGCAGTTCCTTGG

TCCACGGTTCATTAAGCATGTCCGGCTCCGGGAGAAAAGACTTCGATGTGAAGCACATCCTGCGACTCCGCTGGAAACTCTTCAGCCATCCCTCGCCGGC

CTCCAGTAGCCCAGCGGGGGGCAGCTGCCTGCAACAGGACAGCGGAGGAGGCAGCTTTGAGCACTGGGGTCCTAGCCAGAGTCGGCTGCTCAAAAACCAG

GAAAAGGGCAGTGTGAGCGCTTTCTGGAAAAAGCCTTCTTCCTCCTCTTCCTCCTCCTCTTCCTCCTCGTCTTCTGCTTCATCTTCTCCTTTCAATCCGC

TGAATGGCACCTTACTACCAGTTGCCACGAGGCTGCAGCAAGGGGCTCCCGGGCAGGGCACCCAGCAGCCCGCCAGGACTCTTTTCTACGTGGAGTCCCT

AGAGGAGGAGGTAGTGACAGGCATGGACTTTTCTGGACCAGAGGACAAAGGATTGGCCCTGAAAGAGCTCCAAGCGGAGCCTGCCAGCTCTATCCAGGCA

ACAGGTGAAGGATGTGGACACAG GTTGACATCGACCAATCATTCACTGACACCTCAAAGTGATTTGGATTCCAGCAGCTCCGAAGAATTCTATCAAGCT

GTTCACCATGCTGAGCAATCATTTAGAAAGATGGAGAATTATTTAAAGCAACAGCAGCTCTGTGATGTCATCCTGATAGTTGGAAATCGAAAGATACCTG

CTCATAG - UNI33290 - GCTTGTTCTGAGTTCTGTCTCTGACTATTTTGCTGCCATGTTTACAAGTGATGTCTGTGAAGCCAAGCAAGAGGAGATC

AAGATGGAAGGCATAGACCCAAATGCACTCTGGGATCTTGTTCAATTTGCATATACAG - UNI33290 - GTTGCTTGGAATTAAAAGAAGACACTAT

TGAAAACCTTCTTGCAGCTGCTTGCCTTCTCCAGCTCCCTCAAGTGGTCGAAGTGTGTTGTCACTTCCTCATGAAACTTCTGCATCCATCCAACTGTTTA

GGAATAAGGGCATTTGCTGATGCTCAAGGATGCATTGAATTAATGAAGGTGGCACACAGCTACACCATG - UNI33290 - GAAAACATAATGGAAGT

AATCAGAAATCAAGAGTTTTTACTCCTTCCAGCTGAAGAGCTCCATAAACTACTGGCCAGTGATGATGTAAATGTTCCTGATGAAGAGACCATTTTCCAT

GCACTGATGATGTGGGTCAAGTATGACATGCAGCGGAGATGTAGTGACCTGAGTATGCTCCTTGCCTTCATAAGATTACCACTGCTTCCACCACAG ATA

CTGGCTGACCTTGAAAACCATGCACTATTCAAGAATGATTTGGAATGTCAAAAACTGATTCTGGAAGCAATGAAATATCATCTATTGCCCGAAAGAAGAA

CTTTAATGCAAAGTCCAAGAACTAAGCCCAGAAAATCTACAGTTGGAACTCTTTATGCAGTGGGGGGAATGGATAATAACAAAG GGGCTACAACCATAG

AGAAGTATGACCTCCGAACAAATCTGTGGATTCAGGCTGGAATGATGAATGGCAGAAGGCTTCAGTTCGGTGTGGCTGTCATTGATGACAAGCTCTTTGT

AATTGGAGGTCGAGATGGCTTAAAGACTTTGAACACTGTTGAATGTTACAATCCCAAAACCAAGACATGGACTGTTTTGCCACCAATGTCAACACATAGG

CATGGTCTAG GAGTAACTGTACTGGAAGGGCCTATCTATGCAGTGGGAGGCCATGACGGCTGGAGCTATCTGAACACAGTGGAAAGGTGGGATCCCCAG

AGCCAGCAGTGGACATATGTAGCCAGTATGTCCATTGCTCGGAGCACGGTTGGAGTAGCAGCACTGAATGGAAA GTTGTACTCCGTTGGGGGTCGAGAT

GGAAGTTCCTGTCTGAGTTCAATGGAATACTATGATCCTCATACAAATAAGTGGAGCATGTGCGCACCGATGTGTAAGAGGAGAGGGGGTGTTGGAGTGG

CCACCTGTGATGGTTTCCTGTATGCAGTGGGTGGCCATGATGCTCCTGCTTCAAACCACTGTTCCAGGCTCCTGGACTACGTGGAAAG GTATGATCCAA

AAACAGATACATGGACCATGGTGGCTCCTTTGAGTATGCCTAGAGATGCTGTTGGTGTCTGTCTCCTTGGTGACAGGCTATATGCTGTTGGGGGCTATGA

TGGGCAGACTTACCTCAACACCATGGAGTCCTATGATCCACAAACTAATGAGTGGACACAG ATGGCTTCATTGAATATTGGGAGAGCAGGTGCCTGTGT

GGTTGTCATCAAGCAACCTTGACTGATTTATATAATGTTTGAAGGGATTTTCTTTGCTACTGTGGTTATTTTATATCGTGTGGTAAGAGTGAGAAAGAAA

TTCTGAGACAAGAATTTCTCAAGAACAGGATTTTTATAGATTTACCTGCTTGTAACAAAAGCAGTAAAAGATCAAACAGAATTTTAGAAAGAAAAAAAAA

AGGGAACATCAGACACAACATCTGGCCAATAGTTAATTAGTTCAGGAATGGTTATTGATAATGTTTTTCATTGTAGCATACAATAACTAGAATTACCAAA

GGCGGGTTTATCAAAACTGACACATATTTGTGATATAGATAGTTACTTAATGACTGACCGCTTGGTTGTTCTCATAATCTGTGAGGATTCCCAAGAGGTG

GCCAAGAGTAGAAGTTATACTATTTTATCTCACAAATTCTGAACGATTTTATGTTTTTCTAATTGAATGTGATGATAGCAAGAGGCAGAATGTTTTGTTG

AAACAAATATGCTTCTTTCTCATTTTCCTCAGCTATGAAAACAATTAGAGAGACAGATGATTGTCTCTGCATTCAGAAAACAAACTGCCCTGCTAATCAA

GGCTGCATATTGTATCCAAAATGATGATTGGATTTTATTACAACTGTGTCATCAGTCTCGAACTGGCAAACAAAAAGTACTTTCCATAAAGCTTGCCACA

TCGCTTTGCATTGTCAACCCACTGAGCCAAAGAGTCACTGCAGCTATGGGCATTTGCCTCATGCAGAGTTCAGTATAAGCATGGATGTTAGTTATTCTGA

ATGTTAATATACCCACTGCATGCTGAAGTCCCTTAGAATTTTGTTCTTTAAAACAAAACTTAGAATTTTGAGACAAAATTTCCAACTCATTAAATTGGGA

TGATTATGACAACACATAGAAGGGTGACTGACTACATATTCACATTCCCCATTTTCAAAAATCTTACATTGATATGCACATTGTTTTAAACCAAATGTTT

GTAATTGTTCCAAAGCGAAATGTGGAACTTTTATGTAACATCATTAATGTATGTCCATGTAAATTATGAAGATAGTTAATAAATGATAAAACGTTC
Translation
MSGSGRKDFDVKHILRLRWKLFSHPSPASSSPAGGSCLQQDSGGGSFEHWGPSQSRLLKNQEKGSVSAFWKKPSSSSSSSSSSSSSASSSPFNPLNGTLL

PVATRLQQGAPGQGTQQPARTLFYVESLEEEVVTGMDFSGPEDKGLALKELQAEPASSIQATGEGCGHR RLTSTNHSLTPQSDLDSSSSEEFYQAVHHA

EQSFRKMENYLKQQQLCDVILIVGNRKIPAHR - UNI33290 - RLVLSSVSDYFAAMFTSDVCEAKQEEIKMEGIDPNALWDLVQFAYTG - UNI3

3290 - GCLELKEDTIENLLAAACLLQLPQVVEVCCHFLMKLLHPSNCLGIRAFADAQGCIELMKVAHSYTM - UNI33290 - ENIMEVIRNQEFL

LLPAEELHKLLASDDVNVPDEETIFHALMMWVKYDMQRRCSDLSMLLAFIRLPLLPPQ ILADLENHALFKNDLECQKLILEAMKYHLLPERRTLMQSPR

TKPRKSTVGTLYAVGGMDNNKG GATTIEKYDLRTNLWIQAGMMNGRRLQFGVAVIDDKLFVIGGRDGLKTLNTVECYNPKTKTWTVLPPMSTHRHGLG 

GVTVLEGPIYAVGGHDGWSYLNTVERWDPQSQQWTYVASMSIARSTVGVAALNGK KLYSVGGRDGSSCLSSMEYYDPHTNKWSMCAPMCKRRGGVGVAT

CDGFLYAVGGHDAPASNHCSRLLDYVER RYDPKTDTWTMVAPLSMPRDAVGVCLLGDRLYAVGGYDGQTYLNTMESYDPQTNEWTQ MASLNIGRAGAC

VVVIKQP

For any suggestions or comments, please send an email to unitrap@crg.es