Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000022099 (Epb4.9)
Chromosomal location
Chr 14: 71001070 - 71029961 (-)
Description
erythrocyte protein band 4.9 Gene [Source:MGI Symbol;Acc:MGI:99670]
RefSeq_dna
NM_013514 
RefSeq_peptide
NP_038542.1 
UniGene
Mm.406461 Mm.210863 
MGI
MGI:99670 
Uniprot/SWISSPROT
Q9WV69 
Uniprot/SPTREMBL
Q8JZV5 Q9WVM2 Q3TYC5 Q3UEW2 
Human Ortholog
ENSG00000158856 (EPB49)
Omim not available
UniTrap UNI30020
Vector Insertion
Chr 14: 71026545 - 71029962
Public Clones D152F09 (ggtc) (ggtc) IST10172E1 (tigm) IST10172F1 (tigm) IST11840B5 (tigm)
IST13943G3 (tigm) IST10686D8 (tigm) IST14652D4 (tigm) IST13141F11 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI11419
Vector Insertion
Chr 14: 71018216 - 71026545
Public Clones (sanger) D165G03 (ggtc) D099G04 (ggtc) E051C04 (ggtc) D044A04 (ggtc)
D146A12 (ggtc) E130G07 (ggtc) 5SE314D02 (ggtc) M120G09 (ggtc) D123H09 (ggtc)
E127G10 (ggtc) D070H11 (ggtc) FHCRC-GT-S12-6G1 (fhcrc) PST18339-NR (escells)
IST10916H1HMF1 (tigm) IST14431D8 (tigm) IST14897A6 (tigm) IST11705A7 (tigm)
IST11156E7 (tigm) IST14318B8 (tigm) IST10782H1 (tigm) IST11339H11 (tigm)
IST10076D10 (tigm) IST11017B5 (tigm) IST15051C2 (tigm) IST13088A9 (tigm)
IST11569C5 (tigm) IST10030H3 (tigm) IST14271D7 (tigm) IST13269B8 (tigm)
IST10916G1 (tigm) IST11063F3 (tigm) IST14916B9 (tigm) IST11614A9 (tigm)
IST13607C8 (tigm) IST10472D3 (tigm) IST12327H12 (tigm) IST11537D10BBF1 (tigm)
IST12264F12 (tigm) IST11012G2 (tigm) IST13072D3 (tigm) IST14636G10 (tigm)
IST13566E8 (tigm) IST11097G5 (tigm) IST10076E10 (tigm) IST14197D1 (tigm)
IST12123D9 (tigm) IST14178G10 (tigm) IST15071F5 (tigm) IST11097G5BBF1 (tigm)
IST13497B5 (tigm) IST14427F8 (tigm) IST14005D8 (tigm) IST12743H7 (tigm)
IST14395G7 (tigm) IST13635F11 (tigm) IST12753F10 (tigm) IST13398H1 (tigm)
IST10209B12 (tigm) IST11573G10 (tigm) IST10798B5 (tigm) IST12327H11 (tigm)
IST10076C9 (tigm) IST14592E12 (tigm) IST13137C12 (tigm) IST10908F11 (tigm)
IST11567G1 (tigm) IST14337B1 (tigm)
Private Clones OST452128 (lexicon) OST450876 (lexicon) OST425744 (lexicon) OST392968 (lexicon)
OST383126 (lexicon) OST301540 (lexicon) OST297488 (lexicon) OST258436 (lexicon)
OST258103 (lexicon) OST239126 (lexicon) OST231600 (lexicon) OST226636 (lexicon)
OST214146 (lexicon) OST207134 (lexicon) OST207132 (lexicon) OST195687 (lexicon)
OST166123 (lexicon) OST144755 (lexicon) OST136402 (lexicon) OST67811 (lexicon)
OST59287 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI22229
Vector Insertion
Chr 14: 71017837 - 71018045
Public Clones not available
Private Clones OST302881 (lexicon) OST276765 (lexicon) OST232698 (lexicon) OST191772 (lexicon)
OST189077 (lexicon) OST170688 (lexicon)
Severity of mutation (?) Insertion after 2% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI24026
Vector Insertion
Chr 14: 71017248 - 71017761
Public Clones not available
Private Clones OST237238 (lexicon) OST220048 (lexicon) OST215928 (lexicon)
Severity of mutation (?) Insertion after 8% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI22330
Vector Insertion
Chr 14: 71015926 - 71017091
Public Clones not available
Private Clones OST300224 (lexicon)
Severity of mutation (?) Insertion after 21% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI79
Vector Insertion
Chr 14: 71005766 - 71012474
Public Clones GC0345 (tigem) DB0114 (sanger) PST572-1 (escells)
Private Clones not available
Severity of mutation (?) Insertion after 73% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI20869
Vector Insertion
Chr 14: 71004856 - 71005103
Public Clones not available
Private Clones OST349361 (lexicon)
Severity of mutation (?) Insertion after 84% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000022694
Sequence
CAGTGACCTTTATGGAGAACGAAGCCCAGAAGTAGCCCAGAAGTCTGGGCCTGGAACCTTCTTTCTTCCAGAGGGGAGAGTGACCATCCTCTGCTGGGAT

TGCTAATGTGAACTCGCAAGACCCGAGAGCTTCCAAAG - UNI30020 - CGCGGCTGGGTTCCTGGAGAAGCTGCCTCTTACCTAGATTCCTGAGAA

AACGCGGCCACCCAGTCGACCAGGGCCTAGCCTTTTGCTTCCTGGGGCTTCAGAGAGCCTGGGCCCCACTGTCTGGGAGGAG - UNI11419 - - UN

I30020 - CCACCCGCGGTCAGCAGCCCAGAGAGGCCCAAGGGATGAGGACACCACAGAGCGCTGTGACGCCCTCGCTGCAGGAGCCGGGCCGAGCCTG

ACGTCTGTCCTCTCCAAGTGCGCACCGGCCCCCGAGGGAGCGGCCGGCCAGTGGCTGCCGCATGGAACGTCTGCAGAAG - UNI22229 - CAACCTC

TTACCTCCCCGGGGAGCGTCAGCTCCTCCAGAGACTCCAGTGTGCCCGGCTCTCCCTCCAGCATCGTG - UNI24026 - GCCAAGATGGACAACCAG

GTGTTGGGCTACAAGGATCTGGCTGCCATCCCCAAGGACAAGGCCATCCTGGACATTGAGCGACCTGACCTCATGATCTATGAGCCCCACTTTACCTATT

CCCTCCTGGAACATGTAGAGCTGCCCAGAAGCCGGGAG - UNI22330 - TGCTCACTGTCACCCAAATCCACATCCCCCCCACCGTCTCCAGAG GT

GTGGGCGGAGAGCCGGACTCTTGGAATCATCTCTCAGGCTTCAACCCCAAGGACCACAGGGACCCCCAGGACCAGCCTGCCCCACTTCCACCACCCTG A

GACTACCCGCCCGGATTCCAACATCTACAAGAAGCCACCCATCTACAAACAGAGAG AATCCGTGGGAGGCAGCCCTCAGAGCAAGCACCTCATCGAGGA

CCTCATCATCGAATCCTCCAAGTTTCCTGCAGCGCAGCCCCCTGACCCCAACCAGCCAGCCAAGATAGAGACTGACTACTGGCCATGTCCCCCGTCGCTG

GCCGTTGTGG AGACAGAATGGAGGAAACGGAAGGCATCTCGAAAGGGGGCAGAGGAAGAGGAGGAAGAGGAAGACGATGACTCTGAAGAGGAGATTAAG

GCCATCAGGGAACGGCAGAAAGAGGAGCTCAGTAAG GTTACTTCCAACTTGGGAAAGATGATCTTGAAAGAAGAGATGGAAAAGTCATTGCCCATCCGG

AGGAAAACACGCTCTCTGCCTGACCGGACACCCTTCCATACCT - UNI79 - CCTTGCATTCGGGAACATCTAAATCCTCTTCGCTTCCTTCCTATGG

CAGGACCACCCTGAGCCGG CTACAGTCCACAGAATTCAGCCCATCGGGAAGTGAGGCTGGGAGCCCAG GCCTGCAG - UNI20869 - ATCTATCC

CTATGAGATGCTGGTGGTGACCAATAAGGGGAGAACTAAGCTGCCTCCGGGTGTGGACCGCATGAGGCTTGAG AGGCATTTGTCAGCAGAGGACTTCTC

TAGGGTCTTCGCCATGTCTCCCGAGGAGTTTGGCAAGCTGGCCCTGTGGAAGCGGAACGAACTTAAGAAGAAAGCTTCCCTCTTCTGACATCCCTGCCGG

CTCGGCTCGATTCGGCTCGCCCTGTCCGTGACAGTACCTTCCTTCTGCTGCTTCGAGGCCCTGAAGCTGGGGCTGTGAGACCCTTCCCTACAGTGTCCTC

TTCCTCTGCTGGCTGGGAGCAGCGGGAGGCAGGGCAGAAACGTTGGGCTCCATTCCTCACGGAGAGAGCCAAGAAGTGCACAGTCCCAGAGTCACGAGGC

GTGGACTTCCTTCCCCACGATGGGCCAGGGGGCCTTACCATTTCCCTGGGCTCTACTGCCTAGACAAACCCAGCCCGGACTCCAGCACACAATGTTTGCA

CCCGTTCCCTGTCTGTCACCCCACATGAGAGTCCCCAGAAGACAGTGAGGAGAAACGAAGGGGGCTTAGCGGGGAGGTCGGTCTGCTGTCCTGTACAGGG

GGAGGCGGCAGCTCTGGGACCCTGTGCCTGTCCACCCAAAGGCTCCAGCCAGCTGCACTCCTGGCAGTTTCCTGCACTTGGGCCTGATGCTTCTCTAACT

GGCAGAAGCAGGCTCTACCTGGACCTCCAGCTGGGAGGTCATCCTCCCTCTAGCTTGTATGTCCTGTACTTTGCAACCCCTAAGCTTCAAACCTCTTGCT

CAAGACCCAAGACTTATTCAAAGCTGTGGCTAAGAGCAGAGACGCTGTTCACACAACGCCTCACCACCACCAGCCTCCAGGCAAAACCAGATAGGATGCA

CCGTTCTAGCACCTGTCCAGGGACCACCGAGCCCAGGCCTCAGCCTCCCTAAGATGGGATGGAGAGTCCCAGCTCCCAGGTCCCTCCATTGCCATGCATC

TCCTACTGTGCTCTCTACAGAATGTAATTTATTGGGGCACCCTCTGCTGCTTCCCTGACTCCCTGCCCTACCTAATTGCACTTCCAGTCCTGTCTGTCCA

CATATGTACGTGTATATAATTATACATATATATATATCTATTTTGCCCAGGTCTGGGTTTCGTTTTTACCCAGACCCTGGCACTCCCTGTCCACTGTGTG

TGTGATCATGCTGGGAGGGGTAACTGCTTGGAATTAAAAGGTTGCACTGGGTCCCT
Translation
 - UNI30020 -  - UNI11419 - - UNI30020 - MERLQK - UNI22229 - QPLTSPGSVSSSRDSSVPGSPSSIV - UNI24026 - 

AKMDNQVLGYKDLAAIPKDKAILDIERPDLMIYEPHFTYSLLEHVELPRSRE - UNI22330 - CSLSPKSTSPPPSPE VWAESRTLGIISQASTPR

TTGTPRTSLPHFHHPE ETTRPDSNIYKKPPIYKQRE ESVGGSPQSKHLIEDLIIESSKFPAAQPPDPNQPAKIETDYWPCPPSLAVVE ETEWRKRKA

SRKGAEEEEEEEDDDSEEEIKAIRERQKEELSK VTSNLGKMILKEEMEKSLPIRRKTRSLPDRTPFHTS - UNI79 - SLHSGTSKSSSLPSYGRTT

LSR LQSTEFSPSGSEAGSPG GLQ - UNI20869 - IYPYEMLVVTNKGRTKLPPGVDRMRLE RHLSAEDFSRVFAMSPEEFGKLALWKRNELKKK

ASLF
Transcript ENSMUST00000110984
Sequence
AGACTCGGACTCCCCAGCTCCGGGAACCCAAGCCGGTGGCTTGCAGAGCAGCAGGGGACTGGTGAAGCGGGTGGGGGTTCAGGAGGGAGATCAGACCGCT

GAGCTGAGACCAGCTCCCCTCCTTCGCCAGCTCCCACCCCACCCACCCACCCTAAGCCGGCTTTCTTCCTGTTATTTGTGCTTCGTAAAGCGCGGCTGGG

TTCCTGGAGAAGCTGCCTCTTACCTAGATTCCTGAGAAAACGCGGCCACCCAGTCGACCAGGGCCTAGCCTTTTGCTTCCTGGGGCTTCAGAGAGCCTGG

GCCCCACTGTCTGGGAGGAG - UNI11419 - - UNI30020 - CCACCCGCGGTCAGCAGCCCAGAGAGGCCCAAGGGATGAGGACACCACAGAGC

GCTGTGACGCCCTCGCTGCAGGAGCCGGGCCGAGCCTGACGTCTGTCCTCTCCAAGTGCGCACCGGCCCCCGAGGGAGCGGCCGGCCAGTGGCTGCCGCA

TGGAACGTCTGCAGAAG - UNI22229 - CAACCTCTTACCTCCCCGGGGAGCGTCAGCTCCTCCAGAGACTCCAGTGTGCCCGGCTCTCCCTCCAGC

ATCGTG - UNI24026 - GCCAAGATGGACAACCAGGTGTTGGGCTACAAGGATCTGGCTGCCATCCCCAAGGACAAGGCCATCCTGGACATTGAGCG

ACCTGACCTCATGATCTATGAGCCCCACTTTACCTATTCCCTCCTGGAACATGTAGAGCTGCCCAGAAGCCGGGAG - UNI22330 - TGCTCACTGT

CACCCAAATCCACATCCCCCCCACCGTCTCCAGAG GTGTGGGCGGAGAGCCGGACTCTTGGAATCATCTCTCAGGCTTCAACCCCAAGGACCACAGGGA

CCCCCAGGACCAGCCTGCCCCACTTCCACCACCCTG AGACTACCCGCCCGGATTCCAACATCTACAAGAAGCCACCCATCTACAAACAGAGAG AATCC

GTGGGAGGCAGCCCTCAGAGCAAGCACCTCATCGAGGACCTCATCATCGAATCCTCCAAGTTTCCTGCAGCGCAGCCCCCTGACCCCAACCAGCCAGCCA

AGATAGAGACTGACTACTGGCCATGTCCCCCGTCGCTGGCCGTTGTGG AGACAGAATGGAGGAAACGGAAGGCATCTCGAAAGGGGGCAGAGGAAGAGG

AGGAAGAGGAAGACGATGACTCTGAAGAGGAGATTAAGGCCATCAGGGAACGGCAGAAAGAGGAGCTCAGTAAG GTTACTTCCAACTTGGGAAAGATGA

TCTTGAAAGAAGAGATGGAAAAGTCATTGCCCATCCGGAGGAAAACACGCTCTCTGCCTGACCGGACACCCTTCCATACCT - UNI79 - CCTTGCAT

TCGGGAACATCTAAATCCTCTTCGCTTCCTTCCTATGGCAGGACCACCCTGAGCCGG CTACAGTCCACAGAATTCAGCCCATCGGGAAGTGAGGCTGGG

AGCCCAG GCCTGCAG - UNI20869 - ATCTATCCCTATGAGATGCTGGTGGTGACCAATAAGGGGAGAACTAAGCTGCCTCCGGGTGTGGACCGCA

TGAGGCTTGAG AGGCATTTGTCAGCAGAGGACTTCTCTAGGGTCTTCGCCATGTCTCCCGAGGAGTTTGGCAAGCTGGCCCTGTGGAAGCGGAACGAAC

TTAAGAAGAAAGCTTCCCTCTTCTGACATCCCTGCCGGCTCGGCTCGATTCGGCTCGCCCTGTCCGTGACAGTACCTTCCTTCTGCTGCTTCGAGGCCCT

GAAGCTGGGGCTGTGAGACCCTTCCCTACAGTGTCCTCTTCCTCTGCTGGCTGGGAGCAGCGGGAGGCAGGGCAGAAACGTTGGGCTCCATTCCTCACGG

AGAGAGCCAAGAAGTGCACAGTCCCAGAGTCACGAGGCGTGGACTTCCTTCCCCACGATGGGCCAGGGGGCCTTACCATTTCCCTGGGCTCTACTGCCTA

GACAAACCCAGCCCGGACTCCAGCACACAATGTTTGCACCCGTTCCCTGTCTGTCACCCCACATGAGAGTCCCCAGAAGACAGTGAGGAGAAACGAAGGG

GGCTTAGCGGGGAGGTCGGTCTGCTGTCCTGTACAGGGGGAGGCGGCAGCTCTGGGACCCTGTGCCTGTCCACCCAAAGGCTCCAGCCAGCTGCACTCCT

GGCAGTTTCCTGCACTTGGGCCTGATGCTTCTCTAACTGGCAGAAGCAGGCTCTACCTGGACCTCCAGCTGGGAGGTCATCCTCCCTCTAGCTTGTATGT

CCTGTACTTTGCAACCCCTAAGCTTCAAACCTCTTGCTCAAGACCCAAGACTTATTCAAAGCTGTGGCTAAGAGCAGAGACGCTGTTCACACAACGCCTC

ACCACCACCAGCCTCCAGGCAAAACCAGATAGGATGCACCGTTCTAGCACCTGTCCAGGGACCACCGAGCCCAGGCCTCAGCCTCCCTAAGATGGGATGG

AGAGTCCCAGCTCCCAGGTCCCTCCATTGCCATGCATCTCCTACTGTGCTCTCTACAGAATGTAATTTATTGGGGCACCCTCTGCTGCTTCCCTGACTCC

CTGCCCTACCTAATTGCACTTCCAGTCCTGTCTGTCCACATATGTACGTGTATATAATTATACATATATATATATCTATTTTGCCCAGGTCTGGGTTTCG

TTTTTACCCAGACCCTGGCACTCCCTGTCCACTGTGTGTGTGATCATGCTGGGAGGGGTAACTGCTTGGAATTAAAAGGTTGCACTGGGTCCCTAAATCT

ATTGTTTCTATCCATGCCTGTGCATATCAGACAAGCACTGTACCACAACCAGTTGTCTTACCTCTTTTTTTTTTCTTTTTTTCTTTTTCAAGACAGGGTT

TCTCTGTATAGCCCTGGCGGTCCTGGAACTCACTCTGTAGACCAGGCTGGCCTAGAACTCAGAAATCCTCCTGCCTCTGCCTCCCAAGTGCTGGGATTAA

AGCATGTACCACTACTGCTGGGCTAGTCTTACCTCTTTAGTTGCCCAGGCTAGACCTGACCTCTCACTCTGTAGCCCAGGAAGTTTTGGCCTTCTTGGTT

CAGTATCAAGTAGCTGGACGCATAGGCTTAGGCCAGCAGCCTGAACTATCTATTCATTTATTCTGTTTTGTTGTTTTGTTTGAAATAAGGTGTCCCATAG

CAAAGGCTGGTCTTGAACCCCTGATCCAGCATTTGCCTTTCCGAGTGCTGGGATCACAGGCATATATCGCATATTTGTGGATCTTATTTGTCTCACATAG

CTCACACTGGCCTCAAACTTACTTGTATCTGAGGTTGAACTTCCCATCCGCCTTGCCTCTGCCTCACAAGTGCTGGAATACACTGACAGCCATGGTTTAT

TCCGTGCTGGGGATGGAACCCAGGGTCTCTTGCTTGCTAGGTGTGTGCTCTACCAACTGAGCCACATTGATAACCCACGTTTGTTTCTTTATAAGCCACT

AGCCCTGAGACATAGGGACAGGTGACATCAGGTTTCATGTGAGCCAGAGTGGGCTTAGAGACAATACCATAGTCCCGTTCCTCTCTAGGACGCAGGAGCA

AGGGCTGGCCTAGAGAGACTGCTACTTGCCACCTTTCCAGGGGCTCTATGAGACAGAAAGCTATCTTTTGTAGCTAGAGAGAGCTTGACAGAGCCTCAGA

AGATGACCTCAAACACACCGGCCTCCCTAGGACCCAAGGTGCCTCTGCATCAGGGAAGCCCAGCAGAAAACGTTACCAGGAGGTTACCACCTGGCTGCCA

AGCACTGAGCAGAGGAAGCAGGAACGGAGACCTGGTAACTGAGGGACAAATGGTGCCTTGGTGCCTTGATGGCCTCTGACTGCCTTGGTGAAGCCTTCTG

CCTGCAACCACTATGGAGCTGCGTGCCCAAGGTGGGGCTGAGTGTGCAGTTTGATTGGAAGATCAAAAAGAAGACGGGATGGGCTTGCACAGGGGAAGAG

GACCAGCTGGCCCCAAAGCAAATAGATGAGAACCATTCAAAACAATGATTTTCTTACCATTGGAATGGAGTTTACAGCTGAAGACTGCCTTGAATCGCCT

CCCTCTGCTTCTACCTCCTGCGTGTTGAGATGACAGGTGGACACCATTACGCCTGCTTCATTTGGGGCTAGGGAGCCAACCCAGGCTTTGTGTGTGCTAA

GTAGACACTCTGCCTGAAAGACCTACATTCTCAGCTCCCGAATGAACAATGATTTTAAGTAAAGTCGGCTTATGTTTACAGCATTATCCTTGAAACAGAC

CTGCGAGAGCAAGGTTTGTTTGACCCAACAAACGAGAGAGCGTTTTACCTGAAACCCAAGGCTTCATAAAACCAATATGTGTGGTGTGTGTGTGTGTTGG

GGGGCTGAGGGCAGTGTCCTATCTCATTTTGGGGGGAGGGCATTCAGGAGATCAAAGCCAGGGTCTTGGGCCTGCTAGGCAAGCACTCTACTGCAGAGCC

AGCTACATCTCCAGCTGCCCAGCACTGGAGAGATATAGCCATTTTTCCAGGGGAAGCAGGACTGGGTTCCGCATATGTTATCAGACAACATGGACTATGT

GATTATAAAGCGGACCCTGTTTACTTAGAACTCACAGCCGGGCGCTGTAGAAAGTTCACTGGTTACCAAGGGAAGCAACATATGATCAGATTGACTGGAA

ATGTTTGTGGTAGGACAAATTTTGACACTAAGTCCTAAAGGATTTGGAGCTCCTGAGAATTTAGATTCCTTCAAAGTGAGGCTCTTGACCCCCTAAAACA

AAGCCTTAGGGAGAGTCCTTCATGCGTCCTTCTCATGACACAAAGATGTAAAACCTGGGCAACTTTATTGGTTCCCGAAGCTTTTGTTTTGGTTTTATTT

ACTAAACACCTCACCATTTAGAGTCAGGAGCTGAGGGCTTAGAATGCAGCACAGAGCGCTTGCTTAGCATGCATGAGCCCTGGGCTCTCTTGTTAGCAGT

GGACACACCAGGCATATGCCAGATCCCAACACTAAGGAAAGGAAGATTGGGAGTCCAAGGTCAACCTCAGCTACACAGTAAGTTTGAGTCTATCCTGGTC

CATATGAGACCCTGTCTTGAAAAAAGAAAACAAGAGTTGACTTTACAGTCATGAAATCAATGAACAACAAAAATATCTGATAATTAAAAAAAAAACAATG

TGTC
Translation
 - UNI11419 - - UNI30020 - MERLQK - UNI22229 - QPLTSPGSVSSSRDSSVPGSPSSIV - UNI24026 - AKMDNQVLGYKDLA

AIPKDKAILDIERPDLMIYEPHFTYSLLEHVELPRSRE - UNI22330 - CSLSPKSTSPPPSPE VWAESRTLGIISQASTPRTTGTPRTSLPHFHH

PE ETTRPDSNIYKKPPIYKQRE ESVGGSPQSKHLIEDLIIESSKFPAAQPPDPNQPAKIETDYWPCPPSLAVVE ETEWRKRKASRKGAEEEEEEEDD

DSEEEIKAIRERQKEELSK VTSNLGKMILKEEMEKSLPIRRKTRSLPDRTPFHTS - UNI79 - SLHSGTSKSSSLPSYGRTTLSR LQSTEFSPSG

SEAGSPG GLQ - UNI20869 - IYPYEMLVVTNKGRTKLPPGVDRMRLE RHLSAEDFSRVFAMSPEEFGKLALWKRNELKKKASLF
Transcript ENSMUST00000022695
Sequence
AGACTCGGACTCCCCAGCTCCGGGAACCCAAGCCGGTGGCTTGCAGAGCAGCAGGGGACTGGTGAAGCGGGTGGGGGTTCAGGAGGGAGATCAGACCGCT

GAGCTGAGACCAGCTCCCCTCCTTCGCCAGCTCCCACCCCACCCACCCACCCTAAGCCGGCTTTCTTCCTGTTATTTGTGCTTCGTAAAGCGCGGCTGGG

TTCCTGGAGAAGCTGCCTCTTACCTAGATTCCTGAGAAAACGCGGCCACCCAGTCGACCAGGGCCTAGCCTTTTGCTTCCTGGGGCTTCAGAGAGCCTGG

GCCCCACTGTCTGGGAGGAG - UNI11419 - - UNI30020 - CCACCCGCGGTCAGCAGCCCAGAGAGGCCCAAGGGATGAGGACACCACAGAGC

GCTGTGACGCCCTCGCTGCAGGAGCCGGGCCGAGCCTGACGTCTGTCCTCTCCAAGTGCGCACCGGCCCCCGAGGGAGCGGCCGGCCAGTGGCTGCCGCA

TGGAACGTCTGCAGAAG - UNI22229 - CAACCTCTTACCTCCCCGGGGAGCGTCAGCTCCTCCAGAGACTCCAGTGTGCCCGGCTCTCCCTCCAGC

ATCGTG - UNI24026 - GCCAAGATGGACAACCAGGTGTTGGGCTACAAGGATCTGGCTGCCATCCCCAAGGACAAGGCCATCCTGGACATTGAGCG

ACCTGACCTCATGATCTATGAGCCCCACTTTACCTATTCCCTCCTGGAACATGTAGAGCTGCCCAGAAGCCGGGAG - UNI22330 - TGCTCACTGT

CACCCAAATCCACATCCCCCCCACCGTCTCCAGAG GTGTGGGCGGAGAGCCGGACTCTTGGAATCATCTCTCAGGCTTCAACCCCAAGGACCACAGGGA

CCCCCAGGACCAGCCTGCCCCACTTCCACCACCCTG AGACTACCCGCCCGGATTCCAACATCTACAAGAAGCCACCCATCTACAAACAGAGAG AATCC

GTGGGAGGCAGCCCTCAGAGCAAGCACCTCATCGAGGACCTCATCATCGAATCCTCCAAGTTTCCTGCAGCGCAGCCCCCTGACCCCAACCAGCCAGCCA

AGATAGAGACTGACTACTGGCCATGTCCCCCGTCGCTGGCCGTTGTGG AGACAGAATGGAGGAAACGGAAGGCATCTCGAAAGGGGGCAGAGGAAGAGG

AGGAAGAGGAAGACGATGACTCTGAAGAGGAGATTAAGGCCATCAGGGAACGGCAGAAAGAGGAGCTCAGTAAG GTTACTTCCAACTTGGGAAAGATGA

TCTTGAAAGAAGAGATGGAAAAGTCATTGCCCATCCGGAGGAAAACACGCTCTCTGCCTGACCGGACACCCTTCCATACCT - UNI79 - CCTTGCAT

TCGGGAACATCTAAATCCTCTTCGCTTCCTTCCTATGGCAGGACCACCCTGAGCCGG CTACAGTCCACAGAATTCAGCCCATCGGGAAGTGAGGCTGGG

AGCCCAG GCCTGCAG AACGGAGAGGGCCAGAGGGGGAGGATGGATCGGGGGAACTCCCTGCCCTGTGTGCTGGAGCAGAAG - UNI20869 - ATC

TATCCCTATGAGATGCTGGTGGTGACCAATAAGGGGAGAACTAAGCTGCCTCCGGGTGTGGACCGCATGAGGCTTGAG AGGCATTTGTCAGCAGAGGAC

TTCTCTAGGGTCTTCGCCATGTCTCCCGAGGAGTTTGGCAAGCTGGCCCTGTGGAAGCGGAACGAACTTAAGAAGAAAGCTTCCCTCTTCTGACATCCCT

GCCGGCTCGGCTCGATTCGGCTCGCCCTGTCCGTGACAGTACCTTCCTTCTGCTGCTTCGAGGCCCTGAAGCTGGGGCTGTGAGACCCTTCCCTACAGTG

TCCTCTTCCTCTGCTGGCTGGGAGCAGCGGGAGGCAGGGCAGAAACGTTGGGCTCCATTCCTCACGGAGAGAGCCAAGAAGTGCACAGTCCCAGAGTCAC

GAGGCGTGGACTTCCTTCCCCACGATGGGCCAGGGGGCCTTACCATTTCCCTGGGCTCTACTGCCTAGACAAACCCAGCCCGGACTCCAGCACACAATGT

TTGCACCCGTTCCCTGTCTGTCACCCCACATGAGAGTCCCCAGAAGACAGTGAGGAGAAACGAAGGGGGCTTAGCGGGGAGGTCGGTCTGCTGTCCTGTA

CAGGGGGAGGCGGCAGCTCTGGGACCCTGTGCCTGTCCACCCAAAGGCTCCAGCCAGCTGCACTCCTGGCAGTTTCCTGCACTTGGGCCTGATGCTTCTC

TAACTGGCAGAAGCAGGCTCTACCTGGACCTCCAGCTGGGAGGTCATCCTCCCTCTAGCTTGTATGTCCTGTACTTTGCAACCCCTAAGCTTCAAACCTC

TTGCTCAAGACCCAAGACTTATTCAAAGCTGTGGCTAAGAGCAGAGACGCTGTTCACACAACGCCTCACCACCACCAGCCTCCAGGCAAAACCAGATAGG

ATGCACCGTTCTAGCACCTGTCCAGGGACCACCGAGCCCAGGCCTCAGCCTCCCTAAGATGGGATGGAGAGTCCCAGCTCCCAGGTCCCTCCATTGCCAT

GCATCTCCTACTGTGCTCTCTACAGAATGTAATTTATTGGGGCACCCTCTGCTGCTTCCCTGACTCCCTGCCCTACCTAATTGCACTTCCAGTCCTGTCT

GTCCACATATGTACGTGTATATAATTATACATATATATATATCTATTTTGCCCAGGTCTGGGTTTCGTTTTTACCCAGACCCTGGCACTCCCTGTCCACT

GTGTGTGTGATCATGCTGGGAGGGGTAACTGCTTGGAATTAAAAGGTTGCACTGGGTCCCTAAATCTATTGTTTCTATCCATGCCTGTGCATATCAGACA

AGCACTGTACCACAACCAGTTGTCTTACCTCTTTTTTTTTTCTTTTTTTCTTTTTCAAGACAGGGTTTCTCTGTATAGCCCTGGCGGTCCTGGAACTCAC

TCTGTAGACCAGGCTGGCCTAGAACTCAGAAATCCTCCTGCCTCTGCCTCCCAAGTGCTGGGATTAAAGCATGTACCACTACTGCTGGGCTAGTCTTACC

TCTTTAGTTGCCCAGGCTAGACCTGACCTCTCACTCTGTAGCCCAGGAAGTTTTGGCCTTCTTGGTTCAGTATCAAGTAGCTGGACGCATAGGCTTAGGC

CAGCAGCCTGAACTATCTATTCATTTATTCTGTTTTGTTGTTTTGTTTGAAATAAGGTGTCCCATAGCAAAGGCTGGTCTTGAACCCCTGATCCAGCATT

TGCCTTTCCGAGTGCTGGGATCACAGGCATATATCGCATATTTGTGGATCTTATTTGTCTCACATAGCTCACACTGGCCTCAAACTTACTTGTATCTGAG

GTTGAACTTCCCATCCGCCTTGCCTCTGCCTCACAAGTGCTGGAATACACTGACAGCCATGGTTTATTCCGTGCTGGGGATGGAACCCAGGGTCTCTTGC

TTGCTAGGTGTGTGCTCTACCAACTGAGCCACATTGATAACCCACGTTTGTTTCTTTATAAGCCACTAGCCCTGAGACATAGGGACAGGTGACATCAGGT

TTCATGTGAGCCAGAGTGGGCTTAGAGACAATACCATAGTCCCGTTCCTCTCTAGGACGCAGGAGCAAGGGCTGGCCTAGAGAGACTGCTACTTGCCACC

TTTCCAGGGGCTCTATGAGACAGAAAGCTATCTTTTGTAGCTAGAGAGAGCTTGACAGAGCCTCAGAAGATGACCTCAAACACACCGGCCTCCCTAGGAC

CCAAGGTGCCTCTGCATCAGGGAAGCCCAGCAGAAAACGTTACCAGGAGGTTACCACCTGGCTGCCAAGCACTGAGCAGAGGAAGCAGGAACGGAGACCT

GGTAACTGAGGGACAAATGGTGCCTTGGTGCCTTGATGGCCTCTGACTGCCTTGGTGAAGCCTTCTGCCTGCAACCACTATGGAGCTGCGTGCCCAAGGT

GGGGCTGAGTGTGCAGTTTGATTGGAAGATCAAAAAGAAGACGGGATGGGCTTGCACAGGGGAAGAGGACCAGCTGGCCCCAAAGCAAATAGATGAGAAC

CATTCAAAACAATGATTTTCTTACCATTGGAATGGAGTTTACAGCTGAAGACTGCCTTGAATCGCCTCCCTCTGCTTCTACCTCCTGCGTGTTGAGATGA

CAGGTGGACACCATTACGCCTGCTTCATTTGGGGCTAGGGAGCCAACCCAGGCTTTGTGTGTGCTAAGTAGACACTCTGCCTGAAAGACCTACATTCTCA

GCTCCCGAATGAACAATGATTTTAAGTAAAGTCGGCTTATGTTTACAGCATTATCCTTGAAACAGACCTGCGAGAGCAAGGTTTGTTTGACCCAACAAAC

GAGAGAGCGTTTTACCTGAAACCCAAGGCTTCATAAAACCAATATGTGTGGTGTGTGTGTGTGTTGGGGGGCTGAGGGCAGTGTCCTATCTCATTTTGGG

GGGAGGGCATTCAGGAGATCAAAGCCAGGGTCTTGGGCCTGCTAGGCAAGCACTCTACTGCAGAGCCAGCTACATCTCCAGCTGCCCAGCACTGGAGAGA

TATAGCCATTTTTCCAGGGGAAGCAGGACTGGGTTCCGCATATGTTATCAGACAACATGGACTATGTGATTATAAAGCGGACCCTGTTTACTTAGAACTC

ACAGCCGGGCGCTGTAGAAAGTTCACTGGTTACCAAGGGAAGCAACATATGATCAGATTGACTGGAAATGTTTGTGGTAGGACAAATTTTGACACTAAGT

CCTAAAGGATTTGGAGCTCCTGAGAATTTAGATTCCTTCAAAGTGAGGCTCTTGACCCCCTAAAACAAAGCCTTAGGGAGAGTCCTTCATGCGTCCTTCT

CATGACACAAAGATGTAAAACCTGGGCAACTTTATTGGTTCCCGAAGCTTTTGTTTTGGTTTTATTTACTAAACACCTCACCATTTAGAGTCAGGAGCTG

AGGGCTTAGAATGCAGCACAGAGCGCTTGCTTAGCATGCATGAGCCCTGGGCTCTCTTGTTAGCAGTGGACACACCAGGCATATGCCAGATCCCAACACT

AAGGAAAGGAAGATTGGGAGTCCAAGGTCAACCTCAGCTACACAGTAAGTTTGAGTCTATCCTGGTCCATATGAGACCCTGTCTTGAAAAAAGAAAACAA

GAGTTGACTTTACAGTCATGAAATCAATGAACAACAAAAATATCTGATAATTAAAAAAAAAACAATGTGTC
Translation
 - UNI11419 - - UNI30020 - MERLQK - UNI22229 - QPLTSPGSVSSSRDSSVPGSPSSIV - UNI24026 - AKMDNQVLGYKDLA

AIPKDKAILDIERPDLMIYEPHFTYSLLEHVELPRSRE - UNI22330 - CSLSPKSTSPPPSPE VWAESRTLGIISQASTPRTTGTPRTSLPHFHH

PE ETTRPDSNIYKKPPIYKQRE ESVGGSPQSKHLIEDLIIESSKFPAAQPPDPNQPAKIETDYWPCPPSLAVVE ETEWRKRKASRKGAEEEEEEEDD

DSEEEIKAIRERQKEELSK VTSNLGKMILKEEMEKSLPIRRKTRSLPDRTPFHTS - UNI79 - SLHSGTSKSSSLPSYGRTTLSR LQSTEFSPSG

SEAGSPG GLQ NGEGQRGRMDRGNSLPCVLEQK - UNI20869 - IYPYEMLVVTNKGRTKLPPGVDRMRLE RHLSAEDFSRVFAMSPEEFGKLAL

WKRNELKKKASLF

For any suggestions or comments, please send an email to unitrap@crg.es