Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000022112 (Gpc5)
Chromosomal location
Chr 14: 115491848 - 116923659 (+)
Description
glypican 5 Gene [Source:MGI Symbol;Acc:MGI:1194894]
RefSeq_dna
NM_175500 
RefSeq_peptide
NP_780709.1 
UniGene
Mm.320791 
MGI
MGI:1194894 
Uniprot/SWISSPROT
Q8CAL5 
Uniprot/SPTREMBL
O70206 Q14BN1 
Human Ortholog
ENSG00000179399 (GPC5)
Omim not available
UniTrap UNI34676
Vector Insertion
Chr 14: 115532531 - 115768752
Public Clones (sanger) IST11390H8 (tigm) IST12229A12 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI32073
Vector Insertion
Chr 14: 116187555 - 116923501
Public Clones IST11843A10 (tigm) IST12524D9 (tigm) IST14199E7 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 91% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000088488
Sequence
GAGACCCTGGAAACCCTCATCAGACAAGCAGAGAATTACACCAGTATCCTTTTCTGCAACACCTACCGGAACATGGCCTTGGAGGCTGCTGCTTCCATTC

AGGAATTTTTCACGGATGTTGGACTCTATTTATTTGGTGCGGATGTTAATCCCGAGGAATTTGTAAACAGATTCTTTGACAGTCTTTTTCCTCTGGTCTA

CAACCATCTTATAAACCCTGGTGTGACTGACAGTTCTCTGCAATACTCAGAATGCATTCGAATGGCCCGCCAGGATGTTAGTCCATTTGGCAACATTCCC

AAAAGAGTCATGGGGCAGATGGGGAGGTCGCTGCTGCCTGGCCGCACATTCTTGCAGGCGCTTAATCTGGGCATTGAGGTCATCAACACCACGGACCACA

TACACTTCTCCAAGGAGTGCAGTAGGGCCCTCCTGAAGATGCAGTATTGTCCTCACTGCCAGAGCCTGATGCTCAGTAAGCCCTGTATGGGGTACTGCCT

CAATGTCATCAGGGGCTGCCTGGCCCACATGACTGAGCTTAATCCACACTGGCATGCTTATATCCGGTCTTTGGAAGAGTTGTCAGATGCGATGCACGGA

ACCTACGACGTTGAACACGTGCTCCTGAACTTCCACTTGCTTGTTAATGATGCCGTGTTGCAGGCTCACCTCAATGGGCAGAAATTATTGGATCAG GTG

AATACGATTTGTGGCCATCCAGTGAGAACACCAACACAGAGCCCCCGCTGTACTTTTGACCCAAGCAAAGAGAAACATGGAATGAAGATCTCTGCAAGGA

ATGGTGAAGAGACACTTGCCAACAGAAGAAA AGGGATACAGCGTACTGCAGAGAAGCATGCAGTCAGCATCAGGAAGCTGGCTCGAATCCATACTGCTG

AACAAAAGAATGAACAGAGAGTATGGACATCTCTTCTCAAGGACCACCCCCAGTGA
Translation
ETLETLIRQAENYTSILFCNTYRNMALEAAASIQEFFTDVGLYLFGADVNPEEFVNRFFDSLFPLVYNHLINPGVTDSSLQYSECIRMARQDVSPFGNIP

KRVMGQMGRSLLPGRTFLQALNLGIEVINTTDHIHFSKECSRALLKMQYCPHCQSLMLSKPCMGYCLNVIRGCLAHMTELNPHWHAYIRSLEELSDAMHG

TYDVEHVLLNFHLLVNDAVLQAHLNGQKLLDQ VNTICGHPVRTPTQSPRCTFDPSKEKHGMKISARNGEETLANRRK KGIQRTAEKHAVSIRKLARIH

TAEQKNEQRVWTSLLKDHPQ
Transcript ENSMUST00000022707
Sequence
ATGGATGCCCGCACCTGGCGTCTGGGCTGGCGCTGTCTCCTTCTCCTGGCTCTCCTTGGATCTACCCGAAGCGAGGGCGTGGAGAGCTGCGAAGAAGTTC

GGAAACTTTTCCAGTGGCGGCTTGGGGGAGCTGTCAAAGGGCTGCCGGAGGCGCCGCGGGCAG GACCTGATCTTCAGGTTTGCCTATCCAAAAACCCAA

CGTGCTGTACCAGGAAGATGGAGGAGAGGTACCAGATTGCAGCTCGGCAAGATTTGCAGCAGGTGCTTCAGACATCCAGCTCAACATTAAAGTTGCTAAT

ATCTCGAAATGCAGCTGCTTTTCAAG - UNI34676 - AGACCCTGGAAACCCTCATCAGACAAGCAGAGAATTACACCAGTATCCTTTTCTGCAACA

CCTACCGGAACATGGCCTTGGAGGCTGCTGCTTCCATTCAGGAATTTTTCACGGATGTTGGACTCTATTTATTTGGTGCGGATGTTAATCCCGAGGAATT

TGTAAACAGATTCTTTGACAGTCTTTTTCCTCTGGTCTACAACCATCTTATAAACCCTGGTGTGACTGACAGTTCTCTGCAATACTCAGAATGCATTCGA

ATGGCCCGCCAGGATGTTAGTCCATTTGGCAACATTCCCAAAAGAGTCATGGGGCAGATGGGGAGGTCGCTGCTGCCTGGCCGCACATTCTTGCAGGCGC

TTAATCTGGGCATTGAGGTCATCAACACCACGGACCACATACACTTCTCCAAGGAGTGCAGTAGGGCCCTCCTGAAGATGCAGTATTGTCCTCACTGCCA

GAGCCTGATGCTCAGTAAGCCCTGTATGGGGTACTGCCTCAATGTCATCAGGGGCTGCCTGGCCCACATGACTGAGCTTAATCCACACTGGCATGCTTAT

ATCCGGTCTTTGGAAGAGTTGTCAGATGCGATGCACGGAACCTACGACGTTGAACACGTGCTCCTGAACTTCCACTTGCTTGTTAATGATGCCGTGTTGC

AGGCTCACCTCAATGGGCAGAAATTATTGGATCAG GTGAATACGATTTGTGGCCATCCAGTGAGAACACCAACACAGAGCCCCCGCTGTACTTTTGACC

CAAGCAAAGAGAAACATGGAATGAAGATCTCTGCAAGGAATGGTGAAGAGACACTTGCCAACAGAAGAAA AGAATTCATCAATAGCCTTAGGCTGCATG

GGTCCTTCTATGGTGGCCTGGCTGACCAGCTTTGTGTTAATGAATTGGCTGCCCCTGAAGGAAGGCCCTGCTGGAATGGGGAGGAAATAGTCAAAAG CT

ATGCTCAGCGTGTGGTTGGGAATGGAATCAAAGCCCAGTCTGCAAATCCTGAAGTCAGAGTCAGAGGAACCGATCCTGTGGTAAATCAGATCATTGATAA

ACTGAAGCATGTCATCCAG TTGTTACGGGGGAGATCACCCAAGCCCAACAAGTGGGAGCTCCTTCAGCCAGGCAGTGGAGGCGGCATGCTTGAGAACTC

TAGTGGAGACTGTGATGACGAAGATGGCTGTGGAGGATCAGGAAGCGGAGAAGTAAAGAGGACCCTGAAGATCACAAACT - UNI32073 - GGATGC

CAGACAGCATGAACTTCAGTGATGTGAAGCAAGTCCATCGAGCAGACCATGGAAGTACTCTGGATACAACCAGCACCGGATGTGCGTCAGGAACTGAGTC

TATGGCACTCCCTCTGATGGGGACACTGATGTTTCTTCCCTGGCTTTGGTAA
Translation
MDARTWRLGWRCLLLLALLGSTRSEGVESCEEVRKLFQWRLGGAVKGLPEAPRAG GPDLQVCLSKNPTCCTRKMEERYQIAARQDLQQVLQTSSSTLKL

LISRNAAAFQE - UNI34676 - ETLETLIRQAENYTSILFCNTYRNMALEAAASIQEFFTDVGLYLFGADVNPEEFVNRFFDSLFPLVYNHLINPGV

TDSSLQYSECIRMARQDVSPFGNIPKRVMGQMGRSLLPGRTFLQALNLGIEVINTTDHIHFSKECSRALLKMQYCPHCQSLMLSKPCMGYCLNVIRGCLA

HMTELNPHWHAYIRSLEELSDAMHGTYDVEHVLLNFHLLVNDAVLQAHLNGQKLLDQ VNTICGHPVRTPTQSPRCTFDPSKEKHGMKISARNGEETLAN

RRK KEFINSLRLHGSFYGGLADQLCVNELAAPEGRPCWNGEEIVKS SYAQRVVGNGIKAQSANPEVRVRGTDPVVNQIIDKLKHVIQ LLRGRSPKPN

KWELLQPGSGGGMLENSSGDCDDEDGCGGSGSGEVKRTLKITNW - UNI32073 - WMPDSMNFSDVKQVHRADHGSTLDTTSTGCASGTESMALPLM

GTLMFLPWLW

For any suggestions or comments, please send an email to unitrap@crg.es