Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000022119 (Rbm26)
Chromosomal location
Chr 14: 105508999 - 105576544 (-)
Description
RNA binding motif protein 26 Gene [Source:MGI Symbol;Acc:MGI:1921463]
RefSeq_dna
NM_134077 
RefSeq_peptide
NP_598838.3 
UniGene
Mm.291542 
MGI
MGI:1921463 
Uniprot/SWISSPROT
Q6NZN0 
Human Ortholog
ENSG00000139746 (RBM26)
Omim not available
UniTrap UNI22553
Vector Insertion
Chr 14: 105559831 - 105575998
Public Clones (sanger) D097E10 (ggtc) IST14629B5 (tigm) IST14183C5 (tigm)
Private Clones OST291994 (lexicon) OST142040 (lexicon)
Severity of mutation (?) Insertion after 2% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI1066
Vector Insertion
Chr 14: 105559192 - 105559711
Public Clones AX0702 (sanger)
Private Clones OST434263 (lexicon) OST280520 (lexicon) OST278615 (lexicon) OST251763 (lexicon)
OST227115 (lexicon) OST222659 (lexicon) OST211634 (lexicon) OST187706 (lexicon)
OST59665 (lexicon) OST58757 (lexicon)
Severity of mutation (?) Insertion after 7% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI28169
Vector Insertion
Chr 14: 105543508 - 105549469
Public Clones not available
Private Clones OST38235 (lexicon)
Severity of mutation (?) Insertion after 48% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI36910
Vector Insertion
Chr 14: 105523799 - 105527887
Public Clones 3SE285A05 (ggtc) 5SE285A05 (ggtc)
Private Clones not available
Severity of mutation (?) Insertion after 84% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000100327
Sequence
ACTCATTCTCGCGAGATTTACCGGCAGCCATCTTCTTGGGGGTGCTGGAAGCCGGGAAGACCCCCGAACCGTTCCCATTGAGCCGCCCTTCGTTGTCGCT

TTTCTTCACGTCTGCTCTGCCGCGTGGCCACCAACCAAGCACCTAATCCCAAAGCTGAGAGGAGAGCCCGGGTCGGAGCGCGTTCGGCTCCCCTTCGGGA

AGATTCACTGGGGGAGCGGGGCAGGGGGGAGGGCCCGGCCGGCAAACGGTTGCTGCCTCAGCCCGGGCCAGGGTCCGCCGAGGGGAGAAGCTCCGGGGAC

CCGGTGGGCGCGTGGCCTGCGGCGGCCCCCGCCGAGGTGCTCGCCGACCCGCGGCTCGCGGGGACCTGCCACCGGCACCTCCCACCGCTGCCCACGCGGA

CGGCGCGCGGAGGAGGGGGCGGCGGCGGCGACCTGGGCGAGCGCAGGAGCGAGGCCGGCCTCGGGGCCGCGGTGGATGGTTTCTAAGATGATCATCGAAA

ACTTCGAGGCGCTCAAGTCCTGGCTCAGCAAGACCCTCGAGCCCAT - UNI22553 - CTGTGATGCAGATCCATCAGCCCTAGCAAAATATGTTTTG

GCTCTGGTAAAGAAAGACAAAAGTGAAAAAGAATTAAAGGCGTTATGCATTGATCAGCTTGATGTATTTCTTCAGAAAG - UNI1066 - AGACACAA

ATATTTGTTGAAAAACTTTTTGATGCTGTGAATACAAAGAGTTATCTACCTCCTCCAGAGCAGCCATCGTCAGGAAGCCTGAAGGTAGACTTTCTTCAGC

ACCAAGAAAAAGATATAAAAAAAGAAGAG CTCACAAAGGAGGAAGAGCGAGAGAAGAAGTTTTCCAGAAGGTTGAATCACAGCCCTCCCCAGTCAAGCT

CCCGATACAGAGATAATAG AAGCCGTGATGAGAGGAAAAAAGATGATCGTTCTCGAAAAAGAGATTATGATCGAAACCCTCCTCGAAGAGATTCATATA

GAGACCGGTATAACAGAAGGCGAGGGAGAAGTCGCAGTTACAGCAGGAGTCGAAGTCGAAGCTGGAGTAAAGAGAGGCTTCGTGACAGGGATAGAGATAG

GAGCAGAACGAGGAGCAGAAGCAGGACGCGGAGCAGGG AAAGGGACCTGGTGAAACCTAAATATGACCTGGATAGAACAGATCCGTTAGAAAATAATTA

TACACCAGTTTCTTCAGTATCTAATATTTCATCTGGCCACTATCCTGTACCTACTTTGAGCAGCACCATTACCGTCATTGCTCCTACTCATCACGGTAAT

AACACTACCGAAAGTTGGTCTGAATTTCATGAAGACCAGGTGGATCACAACTCTTATGTAAGGCCACCAATGCCAAAGAAACGGTGTAGAGATTATGATG

 AAAAGGGGTTCTGTATGAGAGGAGACATGTGTCCTTTTGATCATGGAAGCGACCCAGTAGTTGTAGAAGATGTGAATCTGCCAGGCATGCTGCCTTTCC

CAGCTCAGCCACCTGTTGTTGAAGGACCACCTCCTCCCGGGCTGCCTCCACCTCCTCCGATCCTTACACCGCCACCTGTGAATCTTAGACCCCCTGTGCC

ACCTCCCGGTCCATTACCACCCAGTCTGCCACCTGTCACAG GACCTCCTCCTCCACTTCCTCCTTTGCAGCCGTCTGGCATGGATGCGCCACCTAACTC

TGCGACCAGCTCTGTCCCTACTGTAGTAACAACTGGCATTCATCACCAGCCTCCTCCTGCTCCACCCTCTCTCTTTACTGCAG ATACATACGATACAGA

TGGCTACAATCCTGAAGCCCCAAGCATAACAAACACTTCCAGACCTATGTATAGACACAGAGTCCATGCACAAAGGCCCAACTTGATAGGACTAACATCA

GGTGACATGGATTTACCACCCAGAG - UNI28169 - AAAAGCCTCCTAATAAAAGCAGTATGAGGATAGTAGTGGATTCAGAATCCAGAAAAAGAAC

TATTGGGTCTGGGGAACCTGGAGTTTCTACAAAGAAGACATGGTTTGATAA ACCAAATTTTAATAGGACAAACAGCCCAGGTTTCCAGAAGAAGGTTCA

GTTTGGAAATGAAAATACTAAACTTGAACTTCGGAAGGTTCCTCCAGAATTAAATAACATCAGCAAACTCAATGAACATTTTAGTCGATTTGGAACATTG

GTTAACTTACAG GTTGCCTATAATGGTGATCCTGAAGGTGCCCTTATTCAATTCGCAACTTATGAAGAAGCAAAGAAAGCAATCTCAAGTACAGAAGCA

GTGTTAAATAATCGTTTTATTAAGGTTTATTGGCACAGAGAAGGAACTACTCAGCAGTTACAAACTACTTCACCAAAG GTAATACAGCCTTTAGTCCAG

CAGCCCATTTTACCTGTTGTGAAGCAGTCAGTCAAAGAGCGGCTGGGTCCTGTACCATCAGCTACAACAGAGCCAGCAGAAGCCCAGAGTGCTACTTCAG

AACTTCCCCAG GTGTTGTCTACATCTACTGGTCTCACAAAAACGGTGTATAATCCAGCTGCTTTGAAGGCTGCACAGAAAACCTTATCAGTTTCTACCC

CTGCAGTTGATAATAATGAAGCACAGAAAAAGAAACAG GAGGCACTGAAACTTCAGCAGGATGTAAGAAAAAGGAAGCAAGAAATTTTAGAAAAGCACA

TTGAAACACAGAAG ATGCTAATTTCAAAACTAGAGAAAAACAAAACCATGAAGTCTGAAGATAAAGCAGAAATAATGAAAACATTGGAGATTTTGACAA

AAAATATTACCAAGTTAAAAGATGAGGTTAAATCTACATCTCCTGGACGCTGTCTTCCCAAAAGTATAAAAACAAAGACTCAG ATGCAGAAAGAATTGC

TTGACACAGAATTGGATTTATATAAGAAGATGCAGGCTGGAGAAGAAGTCACTGAACTTAGGAGAAAATATACAGAATTACAGCTGGAA GCTGCTAAAA

GAGGAATTCTTTCATCTGGCCGAGGTAGAGGAATTCATACAAGAGGTCGAGGTACAGCTCACGGCCGGGGCAGGGGTAGAGGCCGAGGCCGAGGTGTGCC

TGGGCATGCTGTAGTGGATCACCGACCCCGAGCACTGGAGATTTCTGCATTTACAGAGAGTGATAGAGAAGATCTTCTTCCTCATTTTGCG CAATATGG

GGAAATTGAGGACTGTCAGATTGATGACGCTTCACTCCATGCAATAATCACATTCAAGACAAGAGCAGAAGCAGAAGCA GCTGCAATTCACGGCGCTCG

CTTCAAAGGGCAGGATTTGAAGCTGGCCTGGAACAAACCAATAGCTAACATGTCAGCTGTGGACACTGAAGAAGCTGAACCTGATGAAGAGGAA TTTCA

GGAAGAGTCTTTGGTGGATGACTCATTACTTCAAGATGATGACGAAGAAGAAGAGGACAATGAATCTCGTTCTTGGAGAAGATGATTTGACTGATCATTG

ATCTGCATATGCTAGAGCTCTACCTGTGTTTCATTAGTATTATCTAATGGACTGTTACATATTTGTAAAAACAATTTTTGGTAAAATATGATGACGATGG

ATTTCACAAATAGATAAAAGAAGAAAACTACCTTCTGATCTTGTATTTTGAAGATTGATGTTTGCATTTTATTTCAGTAAACAATTGCTAAAGACATCTC

AATAGGACATATGCAATGTTTTTATTACATACTTCTATTGAACATTACAGAATTCTTTGGGTTATTTGTAAATTAATGAATAGATTTGAATACTTATGAC

CCAATACTTGTTATAACATAGAGGATTTTGTTTTACTCCAAATAAGGAATGAATTTGCATTTAAAATCTTAATGAATGTTTTCAAAATGAGTAGATGACA

TAGTATGCTAACTAACGTCTCCAAGTTATGTATTCATAATACTGCACAGTAGTATGCTTAGGCTTTACTATGTATTAGCCGTTTGTTGGATTTGTGTATG

TATTTTATCACATGGGTGTTAATGATAATGGTGTATGACTGCTTTACATATGAGTCCTATGCATCTGGATGCTAAAAATAAAGTGGAATGGTCTCTTAAA

AGAAAAAAGAAAAGAAAAAAAAAAGCAATGACAAAAAAAAATTCATGACAATGTTCCTTGATT
Translation
MVSKMIIENFEALKSWLSKTLEPI - UNI22553 - ICDADPSALAKYVLALVKKDKSEKELKALCIDQLDVFLQKE - UNI1066 - ETQIFVEK

LFDAVNTKSYLPPPEQPSSGSLKVDFLQHQEKDIKKEE LTKEEEREKKFSRRLNHSPPQSSSRYRDNR RSRDERKKDDRSRKRDYDRNPPRRDSYRDR

YNRRRGRSRSYSRSRSRSWSKERLRDRDRDRSRTRSRSRTRSRE ERDLVKPKYDLDRTDPLENNYTPVSSVSNISSGHYPVPTLSSTITVIAPTHHGNN

TTESWSEFHEDQVDHNSYVRPPMPKKRCRDYDE EKGFCMRGDMCPFDHGSDPVVVEDVNLPGMLPFPAQPPVVEGPPPPGLPPPPPILTPPPVNLRPPV

PPPGPLPPSLPPVTG GPPPPLPPLQPSGMDAPPNSATSSVPTVVTTGIHHQPPPAPPSLFTAD DTYDTDGYNPEAPSITNTSRPMYRHRVHAQRPNLI

GLTSGDMDLPPRE - UNI28169 - EKPPNKSSMRIVVDSESRKRTIGSGEPGVSTKKTWFDK KPNFNRTNSPGFQKKVQFGNENTKLELRKVPPEL

NNISKLNEHFSRFGTLVNLQ VAYNGDPEGALIQFATYEEAKKAISSTEAVLNNRFIKVYWHREGTTQQLQTTSPK VIQPLVQQPILPVVKQSVKERLG

PVPSATTEPAEAQSATSELPQ VLSTSTGLTKTVYNPAALKAAQKTLSVSTPAVDNNEAQKKKQ EALKLQQDVRKRKQEILEKHIETQK MLISKLEKN

KTMKSEDKAEIMKTLEILTKNITKLKDEVKSTSPGRCLPKSIKTKTQ MQKELLDTELDLYKKMQAGEEVTELRRKYTELQLE AAKRGILSSGRGRGIH

TRGRGTAHGRGRGRGRGRGVPGHAVVDHRPRALEISAFTESDREDLLPHFA QYGEIEDCQIDDASLHAIITFKTRAEAEA AAIHGARFKGQDLKLAWN

KPIANMSAVDTEEAEPDEEE FQEESLVDDSLLQDDDEEEEDNESRSWRR
Transcript ENSMUST00000077531
Sequence
ACTCATTCTCGCGAGATTTACCGGCAGCCATCTTCTTGGGGGTGCTGGAAGCCGGGAAGACCCCCGAACCGTTCCCATTGAGCCGCCCTTCGTTGTCGCT

TTTCTTCACGTCTGCTCTGCCGCGTGGCCACCAACCAAGCACCTAATCCCAAAGCTGAGAGGAGAGCCCGGGTCGGAGCGCGTTCGGCTCCCCTTCGGGA

AGATTCACTGGGGGAGCGGGGCAGGGGGGAGGGCCCGGCCGGCAAACGGTTGCTGCCTCAGCCCGGGCCAGGGTCCGCCGAGGGGAGAAGCTCCGGGGAC

CCGGTGGGCGCGTGGCCTGCGGCGGCCCCCGCCGAGGTGCTCGCCGACCCGCGGCTCGCGGGGACCTGCCACCGGCACCTCCCACCGCTGCCCACGCGGA

CGGCGCGCGGAGGAGGGGGCGGCGGCGGCGACCTGGGCGAGCGCAGGAGCGAGGCCGGCCTCGGGGCCGCGGTGGATGGTTTCTAAGATGATCATCGAAA

ACTTCGAGGCGCTCAAGTCCTGGCTCAGCAAGACCCTCGAGCCCAT - UNI22553 - CTGTGATGCAGATCCATCAGCCCTAGCAAAATATGTTTTG

GCTCTGGTAAAGAAAGACAAAAGTGAAAAAGAATTAAAGGCGTTATGCATTGATCAGCTTGATGTATTTCTTCAGAAAG - UNI1066 - AGACACAA

ATATTTGTTGAAAAACTTTTTGATGCTGTGAATACAAAGAGTTATCTACCTCCTCCAGAGCAGCCATCGTCAGGAAGCCTGAAGGTAGACTTTCTTCAGC

ACCAAGAAAAAGATATAAAAAAAGAAGAG CTCACAAAGGAGGAAGAGCGAGAGAAGAAGTTTTCCAGAAGGTTGAATCACAGCCCTCCCCAGTCAAGCT

CCCGATACAGAGATAATAG AAGCCGTGATGAGAGGAAAAAAGATGATCGTTCTCGAAAAAGAGATTATGATCGAAACCCTCCTCGAAGAGATTCATATA

GAGACCGGTATAACAGAAGGCGAGGGAGAAGTCGCAGTTACAGCAGGAGTCGAAGTCGAAGCTGGAGTAAAGAGAGGCTTCGTGACAGGGATAGAGATAG

GAGCAGAACGAGGAGCAGAAGCAGGACGCGGAGCAGGG AAAGGGACCTGGTGAAACCTAAATATGACCTGGATAGAACAGATCCGTTAGAAAATAATTA

TACACCAGTTTCTTCAGTATCTAATATTTCATCTGGCCACTATCCTGTACCTACTTTGAGCAGCACCATTACCGTCATTGCTCCTACTCATCACGGTAAT

AACACTACCGAAAGTTGGTCTGAATTTCATGAAGACCAGGTGGATCACAACTCTTATGTAAGGCCACCAATGCCAAAGAAACGGTGTAGAGATTATGATG

 AAAAGGGGTTCTGTATGAGAGGAGACATGTGTCCTTTTGATCATGGAAGCGACCCAGTAGTTGTAGAAGATGTGAATCTGCCAGGCATGCTGCCTTTCC

CAGCTCAGCCACCTGTTGTTGAAGGACCACCTCCTCCCGGGCTGCCTCCACCTCCTCCGATCCTTACACCGCCACCTGTGAATCTTAGACCCCCTGTGCC

ACCTCCCGGTCCATTACCACCCAGTCTGCCACCTGTCACAG GACCTCCTCCTCCACTTCCTCCTTTGCAGCCGTCTGGCATGGATGCGCCACCTAACTC

TGCGACCAGCTCTGTCCCTACTGTAGTAACAACTGGCATTCATCACCAGCCTCCTCCTGCTCCACCCTCTCTCTTTACTGCAG TTTTTGTGTTACCAGA

TACATACGATACAGATGGCTACAATCCTGAAGCCCCAAGCATAACAAACACTTCCAGACCTATGTATAGACACAGAGTCCATGCACAAAGGCCCAACTTG

ATAGGACTAACATCAGGTGACATGGATTTACCACCCAGAG - UNI28169 - AAAAGCCTCCTAATAAAAGCAGTATGAGGATAGTAGTGGATTCAGA

ATCCAGAAAAAGAACTATTGGGTCTGGGGAACCTGGAGTTTCTACAAAGAAGACATGGTTTGATAA ACCAAATTTTAATAGGACAAACAGCCCAGGTTT

CCAGAAGAAGGTTCAGTTTGGAAATGAAAATACTAAACTTGAACTTCGGAAGGTTCCTCCAGAATTAAATAACATCAGCAAACTCAATGAACATTTTAGT

CGATTTGGAACATTGGTTAACTTACAG GTTGCCTATAATGGTGATCCTGAAGGTGCCCTTATTCAATTCGCAACTTATGAAGAAGCAAAGAAAGCAATC

TCAAGTACAGAAGCAGTGTTAAATAATCGTTTTATTAAGGTTTATTGGCACAGAGAAGGAACTACTCAGCAGTTACAAACTACTTCACCAAAG GTAATA

CAGCCTTTAGTCCAGCAGCCCATTTTACCTGTTGTGAAGCAGTCAGTCAAAGAGCGGCTGGGTCCTGTACCATCAGCTACAACAGAGCCAGCAGAAGCCC

AGAGTGCTACTTCAGAACTTCCCCAG AATGTAACTAAGTTATCTGTGAAGGACAGGTTGGGTTTTGTATCAAAGCCATCTGTTTCAGCAACTGAAAAG 

GTGTTGTCTACATCTACTGGTCTCACAAAAACGGTGTATAATCCAGCTGCTTTGAAGGCTGCACAGAAAACCTTATCAGTTTCTACCCCTGCAGTTGATA

ATAATGAAGCACAGAAAAAGAAACAG GAGGCACTGAAACTTCAGCAGGATGTAAGAAAAAGGAAGCAAGAAATTTTAGAAAAGCACATTGAAACACAGA

AG ATGCTAATTTCAAAACTAGAGAAAAACAAAACCATGAAGTCTGAAGATAAAGCAGAAATAATGAAAACATTGGAGATTTTGACAAAAAATATTACCA

AGTTAAAAGATGAGGTTAAATCTACATCTCCTGGACGCTGTCTTCCCAAAAGTATAAAAACAAAGACTCAG ATGCAGAAAGAATTGCTTGACACAGAAT

TGGATTTATATAAGAAGATGCAGGCTGGAGAAGAAGTCACTGAACTTAGGAGAAAATATACAGAATTACAGCTGGAA GCTGCTAAAAGAGGAATTCTTT

CATCTGGCCGAGGTAGAGGAATTCATACAAGAGGTCGAGGTACAGCTCACGGCCGGGGCAGGGGTAGAGGCCGAGGCCGAGGTGTGCCTGGGCATGCTGT

AGTGGATCACCGACCCCGAGCACTGGAGATTTCTGCATTTACAGAGAGTGATAGAGAAGATCTTCTTCCTCATTTTGCG CAATATGGGGAAATTGAGGA

CTGTCAGATTGATGACGCTTCACTCCATGCAATAATCACATTCAAGACAAGAGCAGAAGCAGAAGCA GCTGCAATTCACGGCGCTCGCTTCAAAGGGCA

GGATTTGAAGCTGGCCTGGAACAAACCAATAGCTAACATGTCAGCTGTGGACACTGAAGAAGCTGAACCTGATGAAGAGGAA TTTCAGGAAGAGTCTTT

GGTGGATGACTCATTACTTCAAGATGATGACGAAGAAGAAGAGGACAATGAATCTCGTTCTTGGAGAAGATGATTTGACTGATCATTGATCTGCATATGC

TAGAGCTCTACCTGTGTTTCATTAGTATTATCTAATGGACTGTTACATATTTGTAAAAACAATTTTTGGTAAAATATGATGACGATGGATTTCACAAATA

GATAAAAGAAGAAAACTACCTTCTGATCTTGTATTTTGAAGATTGATGTTTGCATTTTATTTCAGTAAACAATTGCTAAAGACATCTCAATAGGACATAT

GCAATGTTTTTATTACATACTTCTATTGAACATTACAGAATTCTTTGGGTTATTTGTAAATTAATGAATAGATTTGAATACTTATGACCCAATACTTGTT

ATAACATAGAGGATTTTGTTTTACTCCAAATAAGGAATGAATTTGCATTTAAAATCTTAATGAATGTTTTCAAAATGAGTAGATGACATAGTATGCTAAC

TAACGTCTCCAAGTTATGTATTCATAATACTGCACAGTAGTATGCTTAGGCTTTACTATGTATTAGCCGTTTGTTGGATTTGTGTATGTATTTTATCACA

TGGGTGTTAATGATAATGGTGTATGACTGCTTTACATATGAGTCCTATGCATCTGGATGCTAAAAATAAAGTGGAATGGTCTCTTAAAAGAAAAAAGAAA

AGAAAAAAAAAAGCAATGACAAAAAAAAATTCATGACAATGTTCCTTGATT
Translation
MVSKMIIENFEALKSWLSKTLEPI - UNI22553 - ICDADPSALAKYVLALVKKDKSEKELKALCIDQLDVFLQKE - UNI1066 - ETQIFVEK

LFDAVNTKSYLPPPEQPSSGSLKVDFLQHQEKDIKKEE LTKEEEREKKFSRRLNHSPPQSSSRYRDNR RSRDERKKDDRSRKRDYDRNPPRRDSYRDR

YNRRRGRSRSYSRSRSRSWSKERLRDRDRDRSRTRSRSRTRSRE ERDLVKPKYDLDRTDPLENNYTPVSSVSNISSGHYPVPTLSSTITVIAPTHHGNN

TTESWSEFHEDQVDHNSYVRPPMPKKRCRDYDE EKGFCMRGDMCPFDHGSDPVVVEDVNLPGMLPFPAQPPVVEGPPPPGLPPPPPILTPPPVNLRPPV

PPPGPLPPSLPPVTG GPPPPLPPLQPSGMDAPPNSATSSVPTVVTTGIHHQPPPAPPSLFTAV VFVLPDTYDTDGYNPEAPSITNTSRPMYRHRVHAQ

RPNLIGLTSGDMDLPPRE - UNI28169 - EKPPNKSSMRIVVDSESRKRTIGSGEPGVSTKKTWFDK KPNFNRTNSPGFQKKVQFGNENTKLELRK

VPPELNNISKLNEHFSRFGTLVNLQ VAYNGDPEGALIQFATYEEAKKAISSTEAVLNNRFIKVYWHREGTTQQLQTTSPK VIQPLVQQPILPVVKQSV

KERLGPVPSATTEPAEAQSATSELPQ NVTKLSVKDRLGFVSKPSVSATEK VLSTSTGLTKTVYNPAALKAAQKTLSVSTPAVDNNEAQKKKQ EALKL

QQDVRKRKQEILEKHIETQK MLISKLEKNKTMKSEDKAEIMKTLEILTKNITKLKDEVKSTSPGRCLPKSIKTKTQ MQKELLDTELDLYKKMQAGEEV

TELRRKYTELQLE AAKRGILSSGRGRGIHTRGRGTAHGRGRGRGRGRGVPGHAVVDHRPRALEISAFTESDREDLLPHFA QYGEIEDCQIDDASLHAI

ITFKTRAEAEA AAIHGARFKGQDLKLAWNKPIANMSAVDTEEAEPDEEE FQEESLVDDSLLQDDDEEEEDNESRSWRR
Transcript ENSMUST00000022715
Sequence
ACTCATTCTCGCGAGATTTACCGGCAGCCATCTTCTTGGGGGTGCTGGAAGCCGGGAAGACCCCCGAACCGTTCCCATTGAGCCGCCCTTCGTTGTCGCT

TTTCTTCACGTCTGCTCTGCCGCGTGGCCACCAACCAAGCACCTAATCCCAAAGCTGAGAGGAGAGCCCGGGTCGGAGCGCGTTCGGCTCCCCTTCGGGA

AGATTCACTGGGGGAGCGGGGCAGGGGGGAGGGCCCGGCCGGCAAACGGTTGCTGCCTCAGCCCGGGCCAGGGTCCGCCGAGGGGAGAAGCTCCGGGGAC

CCGGTGGGCGCGTGGCCTGCGGCGGCCCCCGCCGAGGTGCTCGCCGACCCGCGGCTCGCGGGGACCTGCCACCGGCACCTCCCACCGCTGCCCACGCGGA

CGGCGCGCGGAGGAGGGGGCGGCGGCGGCGACCTGGGCGAGCGCAGGAGCGAGGCCGGCCTCGGGGCCGCGGTGGATGGTTTCTAAGATGATCATCGAAA

ACTTCGAGGCGCTCAAGTCCTGGCTCAGCAAGACCCTCGAGCCCAT - UNI22553 - CTGTGATGCAGATCCATCAGCCCTAGCAAAATATGTTTTG

GCTCTGGTAAAGAAAGACAAAAGTGAAAAAGAATTAAAGGCGTTATGCATTGATCAGCTTGATGTATTTCTTCAGAAAG - UNI1066 - AGACACAA

ATATTTGTTGAAAAACTTTTTGATGCTGTGAATACAAAGAGTTATCTACCTCCTCCAGAGCAGCCATCGTCAGGAAGCCTGAAGGTAGACTTTCTTCAGC

ACCAAGAAAAAGATATAAAAAAAGAAGAG CTCACAAAGGAGGAAGAGCGAGAGAAGAAGTTTTCCAGAAGGTTGAATCACAGCCCTCCCCAGTCAAGCT

CCCGATACAGAGATAATAG AAGCCGTGATGAGAGGAAAAAAGATGATCGTTCTCGAAAAAGAGATTATGATCGAAACCCTCCTCGAAGAGATTCATATA

GAGACCGGTATAACAGAAGGCGAGGGAGAAGTCGCAGTTACAGCAGGAGTCGAAGTCGAAGCTGGAGTAAAGAGAGGCTTCGTGACAGGGATAGAGATAG

GAGCAGAACGAGGAGCAGAAGCAGGACGCGGAGCAGGG AAAGGGACCTGGTGAAACCTAAATATGACCTGGATAGAACAGATCCGTTAGAAAATAATTA

TACACCAGTTTCTTCAGTATCTAATATTTCATCTGGCCACTATCCTGTACCTACTTTGAGCAGCACCATTACCGTCATTGCTCCTACTCATCACGGTAAT

AACACTACCGAAAGTTGGTCTGAATTTCATGAAGACCAGGTGGATCACAACTCTTATGTAAGGCCACCAATGCCAAAGAAACGGTGTAGAGATTATGATG

 AAAAGGGGTTCTGTATGAGAGGAGACATGTGTCCTTTTGATCATGGAAGCGACCCAGTAGTTGTAGAAGATGTGAATCTGCCAGGCATGCTGCCTTTCC

CAGCTCAGCCACCTGTTGTTGAAGGACCACCTCCTCCCGGGCTGCCTCCACCTCCTCCGATCCTTACACCGCCACCTGTGAATCTTAGACCCCCTGTGCC

ACCTCCCGGTCCATTACCACCCAGTCTGCCACCTGTCACAG GACCTCCTCCTCCACTTCCTCCTTTGCAGCCGTCTGGCATGGATGCGCCACCTAACTC

TGCGACCAGCTCTGTCCCTACTGTAGTAACAACTGGCATTCATCACCAGCCTCCTCCTGCTCCACCCTCTCTCTTTACTGCAG TTTTTGTGTTACCAGA

TACATACGATACAGATGGCTACAATCCTGAAGCCCCAAGCATAACAAACACTTCCAGACCTATGTATAGACACAGAGTCCATGCACAAAGGCCCAACTTG

ATAGGACTAACATCAGGTGACATGGATTTACCACCCAGAG - UNI28169 - AAAAGCCTCCTAATAAAAGCAGTATGAGGATAGTAGTGGATTCAGA

ATCCAGAAAAAGAACTATTGGGTCTGGGGAACCTGGAGTTTCTACAAAGAAGACATGGTTTGATAA ACCAAATTTTAATAGGACAAACAGCCCAGGTTT

CCAGAAGAAGGTTCAGTTTGGAAATGAAAATACTAAACTTGAACTTCGGAAGGTTCCTCCAGAATTAAATAACATCAGCAAACTCAATGAACATTTTAGT

CGATTTGGAACATTGGTTAACTTACAG GTTGCCTATAATGGTGATCCTGAAGGTGCCCTTATTCAATTCGCAACTTATGAAGAAGCAAAGAAAGCAATC

TCAAGTACAGAAGCAGTGTTAAATAATCGTTTTATTAAGGTTTATTGGCACAGAGAAGGAACTACTCAGCAGTTACAAACTACTTCACCAAAG GTAATA

CAGCCTTTAGTCCAGCAGCCCATTTTACCTGTTGTGAAGCAGTCAGTCAAAGAGCGGCTGGGTCCTGTACCATCAGCTACAACAGAGCCAGCAGAAGCCC

AGAGTGCTACTTCAGAACTTCCCCAG AATGTAACTAAGTTATCTGTGAAGGACAGGTTGGGTTTTGTATCAAAGCCATCTGTTTCAGCAACTGAAAAG 

GTGTTGTCTACATCTACTGGTCTCACAAAAACGGTGTATAATCCAGCTGCTTTGAAGGCTGCACAGAAAACCTTATCAGTTTCTACCCCTGCAGTTGATA

ATAATGAAGCACAGAAAAAGAAACAG GAGGCACTGAAACTTCAGCAGGATGTAAGAAAAAGGAAGCAAGAAATTTTAGAAAAGCACATTGAAACACAGA

AG ATGCTAATTTCAAAACTAGAGAAAAACAAAACCATGAAGTCTGAAGATAAAGCAGAAATAATGAAAACATTGGAGATTTTGACAAAAAATATTACCA

AGTTAAAAGATGAGGTTAAATCTACATCTCCTGGACGCTGTCTTCCCAAAAGTATAAAAACAAAGACTCAG ATGCAGAAAGAATTGCTTGACACAGAAT

TGGATTTATATAAGAAGATGCAGGCTGGAGAAGAAGTCACTGAACTTAGGAGAAAATATACAGAATTACAGCTGGAA GCTGCTAAAAGAGGAATTCTTT

CATCTGGCCGAGGTAGAGGAATTCATACAAGAGGTCGAGGTACAGCTCACGGCCGGGGCAGGGGTAGAGGCCGAGGCCGAGGTGTGCCTGGGCATGCTGT

AGTGGATCACCGACCCCGAGCACTGGAGATTTCTGCATTTACAGAGAGTGATAGAGAAGATCTTCTTCCTCATTTTGCG CAATATGGGGAAATTGAGGA

CTGTCAGATTGATGACGCTTCACTCCATGCAATAATCACATTCAAGACAAGAGCAGAAGCAGAAGCA GCTGCAATTCACGGCGCTCGCTTCAAAGGGCA

GGATTTGAAGCTGGCCTGGAACAAACCAATAGCTAACATGTCAGCTGTGGACACTGAAGAAGCTGAACCTGATGAAGAGGAA AGAGAGAACATCACTGC

CTGA
Translation
MVSKMIIENFEALKSWLSKTLEPI - UNI22553 - ICDADPSALAKYVLALVKKDKSEKELKALCIDQLDVFLQKE - UNI1066 - ETQIFVEK

LFDAVNTKSYLPPPEQPSSGSLKVDFLQHQEKDIKKEE LTKEEEREKKFSRRLNHSPPQSSSRYRDNR RSRDERKKDDRSRKRDYDRNPPRRDSYRDR

YNRRRGRSRSYSRSRSRSWSKERLRDRDRDRSRTRSRSRTRSRE ERDLVKPKYDLDRTDPLENNYTPVSSVSNISSGHYPVPTLSSTITVIAPTHHGNN

TTESWSEFHEDQVDHNSYVRPPMPKKRCRDYDE EKGFCMRGDMCPFDHGSDPVVVEDVNLPGMLPFPAQPPVVEGPPPPGLPPPPPILTPPPVNLRPPV

PPPGPLPPSLPPVTG GPPPPLPPLQPSGMDAPPNSATSSVPTVVTTGIHHQPPPAPPSLFTAV VFVLPDTYDTDGYNPEAPSITNTSRPMYRHRVHAQ

RPNLIGLTSGDMDLPPRE - UNI28169 - EKPPNKSSMRIVVDSESRKRTIGSGEPGVSTKKTWFDK KPNFNRTNSPGFQKKVQFGNENTKLELRK

VPPELNNISKLNEHFSRFGTLVNLQ VAYNGDPEGALIQFATYEEAKKAISSTEAVLNNRFIKVYWHREGTTQQLQTTSPK VIQPLVQQPILPVVKQSV

KERLGPVPSATTEPAEAQSATSELPQ NVTKLSVKDRLGFVSKPSVSATEK VLSTSTGLTKTVYNPAALKAAQKTLSVSTPAVDNNEAQKKKQ EALKL

QQDVRKRKQEILEKHIETQK MLISKLEKNKTMKSEDKAEIMKTLEILTKNITKLKDEVKSTSPGRCLPKSIKTKTQ MQKELLDTELDLYKKMQAGEEV

TELRRKYTELQLE AAKRGILSSGRGRGIHTRGRGTAHGRGRGRGRGRGVPGHAVVDHRPRALEISAFTESDREDLLPHFA QYGEIEDCQIDDASLHAI

ITFKTRAEAEA AAIHGARFKGQDLKLAWNKPIANMSAVDTEEAEPDEEE RENITA

For any suggestions or comments, please send an email to unitrap@crg.es