Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000022159 (Rab2b)
Chromosomal location
Chr 14: 52881446 - 52899012 (-)
Description
RAB2B, member RAS oncogene family Gene [Source:MGI Symbol;Acc:MGI:1923588]
RefSeq_dna
NM_172601 
RefSeq_peptide
NP_766189.1 
MGI
MGI:1923588 
Uniprot/SWISSPROT
P59279 
Uniprot/SPTREMBL
Q3TEG7 Q0PD64 Q5U628 Q6P7T7 Q9DB48 
Human Ortholog
ENSG00000129472 (RAB2B)
Omim not available
UniTrap UNI35846
Vector Insertion
Chr 14: 52888592 - 52895186
Public Clones IST10825G6 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 32% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI21763
Vector Insertion
Chr 14: 52888410 - 52888592
Public Clones not available
Private Clones OST318591 (lexicon)
Severity of mutation (?) Insertion after 47% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI21762
Vector Insertion
Chr 14: 52885977 - 52888316
Public Clones not available
Private Clones OST318597 (lexicon)
Severity of mutation (?) Insertion after 63% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000100631
Sequence
GGCAAATAAGGAGACCCGTAGATTGAGTGGCTAGAGAGGTCGGAGGTAAGTGGCTGTAGAAATCGGGAGGACCCGGAACACAGACGCCTCGGGACCATGA

CTTACGCTTATCTCTTCAAGTACATCATCATCGGAGACACAG GTGTGGGGAAGTCATGTCTCCTCCTTCAGTTTACCGACAAGCGGTTCCAGCCCGTGC

ACGACCTCACAATAG - UNI35846 - GTGTGGAGTTTGGAGCACGTATGGTCAACATCGATGGAAAACAAATCAAACTGCAAATCTGGGATACG - 

UNI35846 - GCTGGGCAAGAGTCCTTCCGTTCTATCACCCGTTCCTACTACAGGGGAGCAGCTGGAGCCCTGCTGGTGTATGACATCACGAG - UNI

21763 - - UNI35846 - ACGCGAAACCTTCAACCACCTGACCTCATGGTTAGAGGACGCCCGCCAGCACTCCAGCTCCAACATGGTTATAATGCTG

ATCGGGAATAAGAG - UNI21762 - TGATCTAGAATCTCGAAGGGATGTGAAGAGAGAGGAAGGAGAGGCCTTTGCTCGTGAGCACGGCCTTATATT

CATGGAAACATCAGCCAAGACAGCCTGCAATGTTGAAGAG GCAAATGGCATCAAGATTGGGCCCCAGCAGTCAATTACCTCCTCAGTAGGACCGTGCTC

CCCTCAGCAGAACGTTTCTGACATAGGGCCTGACTCTGGCTGCTGCTGAACACCGGGCCTGAGTGAGCGCTTTCTCTTTCCTCTCGGGGAGCAGCTTCAG

GTCAGCCAGCGCCACGAAGGAGATCCTCGTTGCTTAGGCTGAGAGCAGCCTCTTTTCAGTGTGCGATGTTTCACCCTTCCACTTAAAACATGAGGAGAAA

ATTGGGCCCTTTCCGACCTGTCCTCCTTTAGGGACATGAGCATTCCGCGTAGATTATGGCTCTTTCACCCTCTAGTTTCTAAAATGTTAGAATCAAAGTT

GATTGTCACAGTAGCTAAAAGGCAAACAACTTGCTGTCAACATCTATTTGCTAGGTGTTATGGCACATACCCATAATTTCAGCACTCAGGACTTTTGGCA

AAAGGATTGCCAGGAGTTTTGGAGTCAGTCTGGGCTACATAAGTTTCCCTAGGCCATCTGTCTAAAAAAGCCAAAAAGAAAAGAGAGAAAGGAATAAATA

CATGTGTCTGTTCCTCACCCAATTTTTAGTTGCTAAGGTGAAGGATATTCTGATATAACATTTAGAATTAAGGGTCTGAGTAGCCTTTGGGTGATAGATC

TATACATAGTGATTTCATTGCGTGTATTTCCTTGCCTTGGAAACCTGTGTGTCATATGATAAGAGTTCCTATAGAAGCTGAGTGCCTCTGCACTGTCTCG

TTGCCAGCTCCTTTTTATTTATTATGTGTGTACAACCTTGAGCATCATTCCTTAGGATCCCCGCACATGGGCCCCACATCTCTAGAGTGCCATGCTTAGG

CAAGGCTTGCTGGCCTTTTTCATTGCTAGTTCTTTTCCTTAACTACAGAACGTAGAAAGCAGTGGAGTGGGTACCGGACCTGTCGCCACACACCCTTACC

TAAGAAAACATAAGTTGTTCATTTTGCTTAAAGGACCAGTTCTAGCATTACATTTTCTTTTACCGAATTGCTCTCTCTACTGTTACACACACACACACAC

ACACACACACACACACAGGCACACATGCGAGCCCGTGCACATGCCCTGGAGATTAAGCTAGGTTCTTAAACATGCTTAGGAAGTGCTGAACCTGAGCTGT

GCCCTCAGGAGCCTTCTCTTACTTACACTTTTTGTTTACAGACAGGTTGCTGAGGCTGGCTTTGAACTTGGGATCCTGAGGCTTCAGACTCCCAGGTGGC

TGTTTATTCTCTCTAACCAGCTCTGTTAGATATTTCCTCTAATCAAGCTAATTGGTTACTGAAATGACATATTTATCCCAACTTCTGTACCTTTGCACAA

ACTCTACCCTCTGACCCTCCACTACCATCATACTGACACTCTTTTCCTTTAGGAAACCCTCACTGACTGACCTAGGGAGCCCTACGAAGTTGTTAACACA

GTACTTCTTAGCATTCCTACGTTATCCATATGTATATTTATTTGTATGTGTTTCACGTTATAAATGTTTTGTAGTGAACCCAGGGTGGGTGAGGGGGAAG

CATCTGTCTCACATAGGCTGTAAGCTCTCTGAGAGCAGGCACCTGTCATCCCAGTCCATCCCACCGTTCCCTTACTGTACTCTGCAACTCACCATCTGGA

ATTAAGTGACATGCTTTAAAACTTAAGAGTTTAGAAGAAACAAAAGGCCTTAGAGTCATCTCTATGTAATTGTATCCTGGTTTCCCCATCTCCTTATCCT

GATTTCTCATTGCTCTTCTGTCCTGCCTCACTGTAACTGCCTCCATTCTGTGCAGTCTACAGTAAGAATGCCTGCTTCCAAGACTCAGATACATAGGGAC

GTTTTTACCCGTTCCGTAGACTCTGTAACTGTCAGCCCAGTTTGCCTCTGCTGACTCCTGGCATCACCTCCTGGGACACTTGCTGTCTTTTTTACTTGTC

TCATTTTCTTTCACAGCACTGAGGTCTCACCAAATTTTCTAATTTTTATTGTTAATGACCGTTTTACTATTAAATATATGCATGATCC
Translation
MTYAYLFKYIIIGDTG GVGKSCLLLQFTDKRFQPVHDLTIG - UNI35846 - GVEFGARMVNIDGKQIKLQIWDT - UNI35846 - AGQESFR

SITRSYYRGAAGALLVYDITR - UNI21763 - - UNI35846 - RRETFNHLTSWLEDARQHSSSNMVIMLIGNKS - UNI21762 - SDLESR

RDVKREEGEAFAREHGLIFMETSAKTACNVEE ANGIKIGPQQSITSSVGPCSPQQNVSDIGPDSGCC
Transcript ENSMUST00000022765
Sequence
GGCAAATAAGGAGACCCGTAGATTGAGTGGCTAGAGAGGTCGGAGGTAAGTGGCTGTAGAAATCGGGAGGACCCGGAACACAGACGCCTCGGGACCATGA

CTTACGCTTATCTCTTCAAGTACATCATCATCGGAGACACAG GTGTGGGGAAGTCATGTCTCCTCCTTCAGTTTACCGACAAGCGGTTCCAGCCCGTGC

ACGACCTCACAATAG - UNI35846 - GTGTGGAGTTTGGAGCACGTATGGTCAACATCGATGGAAAACAAATCAAACTGCAAATCTGGGATACG - 

UNI35846 - GCTGGGCAAGAGTCCTTCCGTTCTATCACCCGTTCCTACTACAGGGGAGCAGCTGGAGCCCTGCTGGTGTATGACATCACGAG - UNI

21763 - - UNI35846 - ACGCGAAACCTTCAACCACCTGACCTCATGGTTAGAGGACGCCCGCCAGCACTCCAGCTCCAACATGGTTATAATGCTG

ATCGGGAATAAGAG - UNI21762 - TGATCTAGAATCTCGAAGGGATGTGAAGAGAGAGGAAGGAGAGGCCTTTGCTCGTGAGCACGGCCTTATATT

CATGGAAACATCAGCCAAGACAGCCTGCAATGTTGAAGAG GCCTACATTAATACAGCCAAAGAAATATATAGGAAGATCCAGCAAGGTTTATTTGATGT

CCACAATGAG GCAAATGGCATCAAGATTGGGCCCCAGCAGTCAATTACCTCCTCAGTAGGACCGTGCTCCCCTCAGCAGAACGTTTCTGACATAGGGCC

TGACTCTGGCTGCTGCTGAACACCGGGCCTGAGTGAGCGCTTTCTCTTTCCTCTCGGGGAGCAGCTTCAGGTCAGCCAGCGCCACGAAGGAGATCCTCGT

TGCTTAGGCTGAGAGCAGCCTCTTTTCAGTGTGCGATGTTTCACCCTTCCACTTAAAACATGAGGAGAAAATTGGGCCCTTTCCGACCTGTCCTCCTTTA

GGGACATGAGCATTCCGCGTAGATTATGGCTCTTTCACCCTCTAGTTTCTAAAATGTTAGAATCAAAGTTGATTGTCACAGTAGCTAAAAGGCAAACAAC

TTGCTGTCAACATCTATTTGCTAGGTGTTATGGCACATACCCATAATTTCAGCACTCAGGACTTTTGGCAAAAGGATTGCCAGGAGTTTTGGAGTCAGTC

TGGGCTACATAAGTTTCCCTAGGCCATCTGTCTAAAAAAGCCAAAAAGAAAAGAGAGAAAGGAATAAATACATGTGTCTGTTCCTCACCCAATTTTTAGT

TGCTAAGGTGAAGGATATTCTGATATAACATTTAGAATTAAGGGTCTGAGTAGCCTTTGGGTGATAGATCTATACATAGTGATTTCATTGCGTGTATTTC

CTTGCCTTGGAAACCTGTGTGTCATATGATAAGAGTTCCTATAGAAGCTGAGTGCCTCTGCACTGTCTCGTTGCCAGCTCCTTTTTATTTATTATGTGTG

TACAACCTTGAGCATCATTCCTTAGGATCCCCGCACATGGGCCCCACATCTCTAGAGTGCCATGCTTAGGCAAGGCTTGCTGGCCTTTTTCATTGCTAGT

TCTTTTCCTTAACTACAGAACGTAGAAAGCAGTGGAGTGGGTACCGGACCTGTCGCCACACACCCTTACCTAAGAAAACATAAGTTGTTCATTTTGCTTA

AAGGACCAGTTCTAGCATTACATTTTCTTTTACCGAATTGCTCTCTCTACTGTTACACACACACACACACACACACACACACACACAGGCACACATGCGA

GCCCGTGCACATGCCCTGGAGATTAAGCTAGGTTCTTAAACATGCTTAGGAAGTGCTGAACCTGAGCTGTGCCCTCAGGAGCCTTCTCTTACTTACACTT

TTTGTTTACAGACAGGTTGCTGAGGCTGGCTTTGAACTTGGGATCCTGAGGCTTCAGACTCCCAGGTGGCTGTTTATTCTCTCTAACCAGCTCTGTTAGA

TATTTCCTCTAATCAAGCTAATTGGTTACTGAAATGACATATTTATCCCAACTTCTGTACCTTTGCACAAACTCTACCCTCTGACCCTCCACTACCATCA

TACTGACACTCTTTTCCTTTAGGAAACCCTCACTGACTGACCTAGGGAGCCCTACGAAGTTGTTAACACAGTACTTCTTAGCATTCCTACGTTATCCATA

TGTATATTTATTTGTATGTGTTTCACGTTATAAATGTTTTGTAGTGAACCCAGGGTGGGTGAGGGGGAAGCATCTGTCTCACATAGGCTGTAAGCTCTCT

GAGAGCAGGCACCTGTCATCCCAGTCCATCCCACCGTTCCCTTACTGTACTCTGCAACTCACCATCTGGAATTAAGTGACATGCTTTAAAACTTAAGAGT

TTAGAAGAAACAAAAGGCCTTAGAGTCATCTCTATGTAATTGTATCCTGGTTTCCCCATCTCCTTATCCTGATTTCTCATTGCTCTTCTGTCCTGCCTCA

CTGTAACTGCCTCCATTCTGTGCAGTCTACAGTAAGAATGCCTGCTTCCAAGACTCAGATACATAGGGACGTTTTTACCCGTTCCGTAGACTCTGTAACT

GTCAGCCCAGTTTGCCTCTGCTGACTCCTGGCATCACCTCCTGGGACACTTGCTGTCTTTTTTACTTGTCTCATTTTCTTTCACAGCACTGAGGTCTCAC

CAAATTTTCTAATTTTTATTGTTAATGACCGTTTTACTATTAAATATATGCATGATCC
Translation
MTYAYLFKYIIIGDTG GVGKSCLLLQFTDKRFQPVHDLTIG - UNI35846 - GVEFGARMVNIDGKQIKLQIWDT - UNI35846 - AGQESFR

SITRSYYRGAAGALLVYDITR - UNI21763 - - UNI35846 - RRETFNHLTSWLEDARQHSSSNMVIMLIGNKS - UNI21762 - SDLESR

RDVKREEGEAFAREHGLIFMETSAKTACNVEE AYINTAKEIYRKIQQGLFDVHNE ANGIKIGPQQSITSSVGPCSPQQNVSDIGPDSGCC

For any suggestions or comments, please send an email to unitrap@crg.es