Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000022178 (Jub)
Chromosomal location
Chr 14: 55186312 - 55196251 (-)
Description
ajuba Gene [Source:MGI Symbol;Acc:MGI:1341886]
RefSeq_dna
NM_010590 
RefSeq_peptide
NP_034720.2 
UniGene
Mm.100253 Mm.408305 
MGI
MGI:1341886 
Uniprot/SWISSPROT
Q91XC0 
Uniprot/SPTREMBL
Q9CZW7 
Human Ortholog
ENSG00000129474 (JUB)
Omim not available
UniTrap UNI15057
Vector Insertion
Chr 14: 55192228 - 55196252
Public Clones (sanger) PST14003-NR (escells) IST10460B5 (tigm) IST12201B7 (tigm)
IST10837E10 (tigm)
Private Clones OST451285 (lexicon) OST361074 (lexicon) OST359635 (lexicon) OST280774 (lexicon)
Severity of mutation (?) Insertion after 63% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI10754
Vector Insertion
Chr 14: 55190671 - 55192228
Public Clones P145A06 (ggtc) (ggtc) P147E06 (ggtc) PST12-1 (escells) PST424-1 (escells)
PST1606-1 (escells) PSTVU01.E19G (vanderbilt)
Private Clones not available
Severity of mutation (?) Insertion after 69% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI19840
Vector Insertion
Chr 14: 55189345 - 55190437
Public Clones (sanger)
Private Clones OST379119 (lexicon)
Severity of mutation (?) Insertion after 77% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000054487
Sequence
CGGGCACCCGGCACCTGGGCCGCTCGCTGAGCCCCCGTGAGTGACTTGCATCCCAGGAATCCGAGCCCCGGGGAACTCGAGCCCGGCCTCTGGCCGAAAC

ACTGCAGCGTGCCGGGCGAGGAGGGGGCTGCAGGCCCCAGATCCGTGGGCATGGAACGGTTAGGGGAGAAAGCCAGTCGTCTGCTAGAAAAGTTGAGACT

CTCGGACTCCGGCAGCGCCAAGTTCGGCCGCAGAAAGGGCGAAGCGAGCCGGTCTGGGTCTGATGGGACCCCCGGAGCAGGCAAGGGACGCTTAAGCGGG

TTGGGGGGACCTAGGAAGTCAGGACACCGTGGAGCGAATGGGGGGCCTGGAGATGAACCTTTGGAACCGGCCAGGGAGCAAGGGCCCCTGGACGCCGAGC

GGAACGCACGCGGCTCCTTTGAAGCGCAGCGCTTCGAAGGGTCCTTTCCCGGGGGGCCGCCGCCCACTCGAGCCCTGCCTCTGCCTCTGTCGTCGCCTCC

TGATTTTCGGCTGGAGACCACGGCTCCAGCCCTTAGCCCTCGCTCCAGCTTCGCCAGTAGCTCGGCCAGCGATGCGAGCAAGCCATCTAGCCCCCGGGGC

AGCCTGCTGCTGGACGGAGCCGGGGCCAGCGGAGCCGGAGGTAGCCGGCCGTGCAGCAATCGGACCAGCGGCATCAGCATGGGCTACGACCAGCGCCACG

GGAGCCCGCTGCCCGCGGGGCCGTGCCTATTCGGCCTCCCGCTGACCACTGCTCCTGCGGGCTACCCTGGAGGGGCTCCGTCCGCCTACCCGGAGCTCCA

CGCTGCCCTGGACCGACTATGTGCCCATCGGTCCGTGGGATTCGGCTGCCAGGAGAGCCGTCACTCGTACCCCCCGGCCCTGGGCAGCCCCGGAGCTCTA

ACCGGAGCCGTGGTGGGAACAGCGGGTCCTTTGGAGAGACGTGGGGCGCAACCCGGACGACACTCGGTTACAGGCTACGGGGACTGCGCCGCGGGGGCCC

GTTACCAGGACGAGCTAACAGCATTGCTGCGTTTGACCGTGGCTACCGGTGGGCGAGAAGCGGGTGCTCGCGGGGAACCCTCGGGGATTGAGCCGTCGGG

TCTGGAGGAGTCTCCTGGTCCCTTCGTTCCAGAGGCCTCCCGATCACGGATACGGGAGCCAGAGGCCAGAGAAGATTACTTTG - UNI15057 - GCA

CCTGTATCAAGTGCAACAAAGGTATCTATGGGCAGAGCAATGCCTGCCAGGCCCTGGACAGCCTCTACCACACCCAGTGCTTTGTCTGCTGCTCCTGTG 

- UNI10754 - - UNI15057 - GACGAACTTTGCGGTGCAAGGCTTTCTACAGCGTCAATGGCTCTGTCTACTGTGAGGAAGACTATCTG TTTTC

AGGGTTTCAGGAGGCAGCTGAGAAGTGCTGTGTCTGCGGCCACTTGATTCTAGAGAAG - UNI19840 - ATCCTCCAGGCCATGGGGAAGTCCTATC

ACCCGGGCTGCTTCCGATGCATCGTATGTAACAAGTGCCTGGACGGCGTCCCCTTCACTGTGGACTTCTCCAACCAGGTGTACTGTGTTACCGACTACCA

CAA AAATTACGCCCCGAAATGTGCAGCCTGCGGACAACCCATCCTCCCCTCAGAG GGCTGTGAGGACATTGTGAGGGTGATATCCATGGACCGTGATT

ATCACTTTGAGTGCTACCACTGTGAG GACTGCCGCATGCAGCTGAGTGACGAGGAAGGTTGCTGCTGTTTCCCTCTTGATGGACATTTGCTCTGCCACG

GCTGTCACATGCAGCGCCTCAGTGCCCGGCAGCCCTCTACCAACTATATCTGAGCTGACGTTACTGCTGCCACCACCACTGTGGAGAAACTCTCTGGCCA

GCGGAGGCAAGGAGTGTATTCTGCAATCCTTGTGAAGAGGTCTCTGGGGAGGCCCCGAAGGCCAGAGACCCAAAGATCCTAACATTCCAAATGGGCTGCG

GAGGAGGAACCTTCTGGTTGCCGGGAGAGTTGACTGGTGTTCATTGCGTGCAGCCTGTGCTACAGTAGATGGGATGTAGCACACGCAGGCGGGTTTCAGT

ACTTCCTGAACGCCAGATTATAATGTATTTTTCCAGTGTATGTTTCTATATACGTCACACAATGTTCTGGTGCTGGATCACATGAGGGCATCACAGAAAC

CACCCCCAGTCTGTTGTACCCTATGCATGGAGTCAGTGGAACCTTTCCCACGGGATCCTATCTTTGTCTGCGCTAAGGGCTGGAAGCCCTGGACTTTGTG

ATGAGCCATTTCTTGGCTCTCTCCCTAAGGACTAGAGAGCTCCCCGTGTCTGTCTGCTGGGACTGGGACCAGCTCTGGGGGACCTTGCTGCCTGTGTTGC

CTGTTTCTCAGGGACCTGGGGAGGCTAACTGGGGCCTGTCCCTGGTTGCTGTTTTGCTCTTCTGGGGGAAGAAATGAGCAGGTTTCTGGATGTGAAACTT

GCCGGTGAGTAGGATGTCCCTGAAGCATCAGGCTAGCCCCACTCCCCCTGTTTAAGTGCACTGAGCCTGTAGCCCAGCATATGTGGATACATTGTAGCCA

CGTGTGCCTGTGCACCTCCCTCCCTACTCCTCTTTTCTCAGGTGACTTACGCTTAGTTCCCTAGCAGTAGCCTATCTTTTGAGACCCCTTTTTAAAAGGG

ATCCTGCATTGGATCTGACCTGTTACAACCCCACCACTCAAGGCATTGGGGAAGCTGGAGAGAAGAAAAATAGGTTGACTTGGTTCTAGCCGCTTGGCTG

AAACTTGAATTCCCCTTAAGCAGGATGTCTTAAAGCCAGGTCACTTGCTGGCTGGAACTCAAGTTCATTTGATGACCAGGTTGCCAAGAGTCCTGTCCCC

TACTGAGTGTTCTTATAGCTGCCTACATGTTTTGTTCTTTTCATTGCACTGAGCATTCAGTGATTCCTGCCTGTTCATCAAGAGTATGTCAGAGGTTTGT

TTGGTTTTTGGTTTTTCGAGACAGGGTTTCTCTGTATAGCTCTGGCTGTCCTGGAACTCACTCTGTAGACCAGGCTGGCCTTGAACTCAGAAATCCGCCT

GCCTCTGCCTCCCAAGCGTGGGATTAAAGGCGTGCGCCACCACGCCTGGCTTACTTCAGAGTTATTAGCAACCTACATTTATCAACTTTGTGGCACTTTG

TGATACAAATGTTCCCTGCCTCCTTGGGTGTCTTCCTACTATGCCATTATTTCTCTGACACTTAAGAAAGAAAAAGTTGAAATTCTAGCAGTAAATACAG

TTGATGCAG
Translation
MERLGEKASRLLEKLRLSDSGSAKFGRRKGEASRSGSDGTPGAGKGRLSGLGGPRKSGHRGANGGPGDEPLEPAREQGPLDAERNARGSFEAQRFEGSFP

GGPPPTRALPLPLSSPPDFRLETTAPALSPRSSFASSSASDASKPSSPRGSLLLDGAGASGAGGSRPCSNRTSGISMGYDQRHGSPLPAGPCLFGLPLTT

APAGYPGGAPSAYPELHAALDRLCAHRSVGFGCQESRHSYPPALGSPGALTGAVVGTAGPLERRGAQPGRHSVTGYGDCAAGARYQDELTALLRLTVATG

GREAGARGEPSGIEPSGLEESPGPFVPEASRSRIREPEAREDYFG - UNI15057 - GTCIKCNKGIYGQSNACQALDSLYHTQCFVCCSCG - UNI

10754 - - UNI15057 - GRTLRCKAFYSVNGSVYCEEDYL FSGFQEAAEKCCVCGHLILEK - UNI19840 - ILQAMGKSYHPGCFRCIVCN

KCLDGVPFTVDFSNQVYCVTDYHK KNYAPKCAACGQPILPSE GCEDIVRVISMDRDYHFECYHCE DCRMQLSDEEGCCCFPLDGHLLCHGCHMQRLS

ARQPSTNYI

For any suggestions or comments, please send an email to unitrap@crg.es