Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000022179 (4931414P19Rik)
Chromosomal location
Chr 14: 55202500 - 55224745 (-)
Description
RIKEN cDNA 4931414P19 gene Gene [Source:MGI Symbol;Acc:MGI:1921609]
RefSeq_dna
NM_028890 
RefSeq_peptide
NP_083166.1 
UniGene
Mm.79815 
MGI
MGI:1921609 
Uniprot/SWISSPROT
Q8K2W9 
Uniprot/SPTREMBL
Q3TR30 
Human Ortholog
ENSG00000100802 (C14orf93)
Omim not available
UniTrap UNI31229
Vector Insertion
Chr 14: 55213950 - 55224746
Public Clones (sanger) IST14985E7 (tigm) IST14252C9 (tigm) IST14397A3 (tigm) IST14478F9 (tigm)
IST11548B7 (tigm) IST13902C9 (tigm) IST11274H2 (tigm) IST12793D2 (tigm)
IST11523G2 (tigm) IST13763E9 (tigm) IST10355E6 (tigm) IST14121A2 (tigm)
IST14521C11 (tigm) IST12263F4 (tigm) IST11169F2 (tigm) IST10281A8 (tigm)
IST13585E11 (tigm) IST11689D1 (tigm) IST13372A12 (tigm) IST11727G5 (tigm)
IST12505G5 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI36993
Vector Insertion
Chr 14: 55209958 - 55214789
Public Clones CMHD-GT_537E1-5S (cmhd)
Private Clones not available
Severity of mutation (?) Insertion after 37% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI35206
Vector Insertion
Chr 14: 55204772 - 55210277
Public Clones IST11405F2 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 57% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000022786
Sequence
CAAAGAGCCATACGACCTTCGAGTATCCTTTTTCCATTTTTTTTCCTCCTTCATCTTGTGTGCGTTTTCCAAATTTTTAAAAATAGAGATCTGTGGCAGT

GCTGGG - UNI31229 - TGAAGGCCGTGGGACACCATTGTGCTGCGTACTTAGGGAGTACAGGACCTGCTAATGGAAAGCTGAGGAGAAGCAACCAT

GGACCTGCTAGGCTACTCCTCCACAGAACCCACAGCCCGGAGCCCCATCTCTTCTGACCACCGTCTATGAAGCGCATCCCTGGCGAAGGCCAGTTACTTG

GAGCACTTGTGAAGCGACCTATTAGAGTGTGCACAGTTACCTGCGTCTATCAACTATGTCCTTTAGTGCCACCATTCTTTTCTCCCCTCCCAGTGGCAGT

GAAGCCAGATGCTGCTGCTGTGCCTGTAAGAGCGAGACTAGCCAGGGCAGCACGGGTTCTCAGGGCGGGAATCCTCCCGCCAGTACCCCCATCACAGTGA

CTGGACATGGCCTGGCGGTCCAAAGCTCTGAACAGCTCCTGCACATTATCTACCAGCGGGTGGACAAGGCAGTGGGTCTGGCTGAGGCCGCCCTGGGGCT

TGCGCGGGCCAACAATGAGTTGTTAAAACAGCTCCAGGAAGAAGTGGGTGAGCTACGGCAGGGGAAAGTGTGCACCGCTGATGAAGATAGGGAGAGCCGG

GCCCGCACCCCACCACCCGAAGAGCCTGGAGTGCTCAAGGGAAGTCCAGGAGAAGCCAGCAACTCTCTGCCTGCCATGGAGGAGGAGTGTGATAGCGTGG

GCAGTGGCGTGCAGGTGGTGATCGAGGAGCTGCGGCAACTGGGGGCTGCCTCCACCGTTGGGCAGGGGCCCTTGGGCTTCTTCGCAGCCCCCCAGAGAGA

TGCGCGCCTTCCAGGGTGCACTCTGGCTGCGGTAGAGGGAGCTCCGCTGCTCAACCCG - UNI31229 - - UNI35206 - ATGGCAGACGACTAT

GTGGCCTCTGAGGGTTCAATACAACGAGTGCTGGTCCCCGCTTATGCCAAACAGCTTTCGCCAGCCACACAATTGGCTATCCAGAGGGCATCCTCAGAGA

CAGGCCCAGAAAGTGGAACCAAGCTGCCCGCAACGCGCCCTGAGGGTGTGCTCGGCTCTGCAGCTCTGGACAGTGCCTTGGACGAGTCAGGCGCTGGAGG

CGCTGGGGAATTGAGCCGCTCTCTTGGATTTGTTGGCTCCCCATGCAGGATCCGAGGGACTGGCCAGAAAAACTCCAGGCGGAAGCGAGATCTGGTGCTC

TCC - UNI35206 - AAACTGGTCCACAATGTGCATAACCACATCACCAATGACAAGAGATTCAATGGGTCAGAAAG - UNI35206 - CATTAAG

TCGTCTTGGAATATTTCAGTAGTGAAGTTCCTTCTGGAAAAGCTCAAGCAGGAGCTGATGGTGAGCCCCCACAATTACACAGACAAGGAGCTGAAGG GA

GCCTGTGTGGCCTACTTCCTTACCAAGAGGCGAGAGTACCGCAATTCTCTCAACCCTTTCAAAGGCCTAAAGGAGAAAGAGGAGAAGAAACTTCGAAGTC

GCCGATACCGG CTTTTCGCCAATCGATCCAGTATCATGAGGCACTTCGGACCCGAGGACCAGCACCTGTGGAAGGACGTGACAGAAGAGCTGATGTCCG

ACGAGGAGGACAGTCTTAATGAGCCAGGTGTGTGGGTGGCCCGCTCGCCCCGATTCAGGGCCCAGCGCCTCACAGAGCTCTGCTACCACCTGGATGCTAA

CTCTAAGCACGGCACCAAAGCCAACCGCGTCTACGGGCCTCCCTCAGACAGACTGCCTTCTGTGGAGGCCCAACTCCTTCCTCCCGAGCTGTACAACCCC

AATTTCCAAGAAGACGAAGGAGGGGGCAATGAGAAAGGACCTGTCTCCCCATCTTATGACCAGCCCCACAAGACATCCTGTCCTGACTTGAACTCGTTTA

TTGAAATCAAGGTGGAAAAGGATGAATACACTCTATAACAAGGCTAACTGGCTCCTCCCACTCTCCACATCCTGGAAAGGATGGCTCGGATTGGTAAAAG

AAAATCTGCTTTTCTTAACATAGTTTCCACTTGAAGTGGAATAGCAGAACTTATGTAGAAGGCAGGGGAGGTCTTTCTCCCTGTGAATGGCAGCCCAGAA

AATGTTTATCCCTAAGTATAAACAGTGCCTCAGAGGAGCCTGGGATGCAAAGGAGGATGGGCCAAAGAAACATGAGGCCTTGATCCATGTCGTGAGGCCT

TGATCCATGTCGTGAGGCCTTGATCCATGTCCCCTCTCTGATTTGGTTTGCCCCCCACTCTCCCACCCCACCCCACCCCACTGTACCCCACAGCTCAGGA

GAAACATTGCTGGTCTTGTGCTGCCCCGGAGGCTGAAGAGAGCAGTCCAGGGTCATACTGCCCCCTGGTGGGAAGTTTCAGTCATGGGCTTTCTAGTCTG

AGCAGGGAATTATGGGCTTACCGCTATTTGGAATTAGGATGTAGATATGATAGTTATTGTTTGGATTTTTTAAATGATAGTTATTGTTTGTTGGATTATA

TGAGAAAAGTTTATTATTTCCATATTACACGTGAGGAAATTAAAGCTTAAACATTT
Translation
 - UNI31229 - MSFSATILFSPPSGSEARCCCCACKSETSQGSTGSQGGNPPASTPITVTGHGLAVQSSEQLLHIIYQRVDKAVGLAEAALGLARAN

NELLKQLQEEVGELRQGKVCTADEDRESRARTPPPEEPGVLKGSPGEASNSLPAMEEECDSVGSGVQVVIEELRQLGAASTVGQGPLGFFAAPQRDARLP

GCTLAAVEGAPLLNP - UNI31229 - - UNI35206 - MADDYVASEGSIQRVLVPAYAKQLSPATQLAIQRASSETGPESGTKLPATRPEGVLGS

AALDSALDESGAGGAGELSRSLGFVGSPCRIRGTGQKNSRRKRDLVLS - UNI35206 - KLVHNVHNHITNDKRFNGSES - UNI35206 - SIK

SSWNISVVKFLLEKLKQELMVSPHNYTDKELKG GACVAYFLTKRREYRNSLNPFKGLKEKEEKKLRSRRYR LFANRSSIMRHFGPEDQHLWKDVTEEL

MSDEEDSLNEPGVWVARSPRFRAQRLTELCYHLDANSKHGTKANRVYGPPSDRLPSVEAQLLPPELYNPNFQEDEGGGNEKGPVSPSYDQPHKTSCPDLN

SFIEIKVEKDEYTL

For any suggestions or comments, please send an email to unitrap@crg.es