Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000022185 (Acin1)
Chromosomal location
Chr 14: 55261005 - 55305768 (-)
Description
apoptotic chromatin condensation inducer 1 Gene [Source:MGI Symbol;Acc:MGI:1891824]
RefSeq_dna
NM_023190 
RefSeq_peptide
NP_001078941.2 NP_062513.3 NP_075679.2 NP_001078942.2 
UniGene
Mm.297078 
MGI
MGI:1891824 
Uniprot/SWISSPROT
Q9JIX8 
Uniprot/SPTREMBL
Q3UZ28 Q05D19 Q3UXT9 Q52KR6 Q7TSL7 Q80TU6 
Human Ortholog
ENSG00000100813 (ACIN1)
Omim not available
UniTrap UNI12069
Vector Insertion
Chr 14: 55281121 - 55282423
Public Clones W212C04 (ggtc)
Private Clones not available
Severity of mutation (?) Insertion after 100% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI10852
Vector Insertion
Chr 14: 55272077 - 55281004
Public Clones D004B07 (ggtc) D001H07 (ggtc) D030A05 (ggtc) D026H06 (ggtc) W212C03 (ggtc)
D036C01 (ggtc)
Private Clones not available
Severity of mutation (?) Insertion after 100% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI23678
Vector Insertion
Chr 14: 55270553 - 55270696
Public Clones CMHD-GT_375C9-3 (cmhd)
Private Clones OST249438 (lexicon)
Severity of mutation (?) Insertion after 100% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI37994
Vector Insertion
Chr 14: 55270553 - 55272077
Public Clones (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 100% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI4309
Vector Insertion
Chr 14: 55265674 - 55266924
Public Clones AG0135 (sanger) PST3909-NR (escells) PST12485-NL (escells) PST8456-NR (escells)
PST13462-NR (escells) PST2764-NR (escells) PST3941-NL (escells) PST3941-NR (escells)
PST13753-NR (escells) PST5172-NL (escells) PST10964-NR (escells) PST3909-NL (escells)
PST711 (escells) PST13626-NR (escells) PST5876-NL (escells)
Private Clones not available
Severity of mutation (?) Insertion after 100% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI37452
Vector Insertion
Chr 14: 55263520 - 55264194
Public Clones PST21526-NR (escells)
Private Clones not available
Severity of mutation (?) Insertion after 100% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000100564
Sequence
ATAGCCGAATATCTCCGATTATGGGTATGCCAGATTCGAGGGCTTCCGAAGAGATTCGATTCAAAGCCCCGGCAAGCCGAAAACAAACGAGCCTGAAAGC

CAGATGGGAGGGGCCAGCCGCTAGGTAGATGGAAAAAGCCGATTGGTACCGATGTGGGGACGGAAACGACCGAACAGCTCCGGAGAAACCCGGGGAATTC

TGAGCGGTAATAGAGGGGTAGACTATGGCAGTGGGCGGGGCCAATCCGGTCCGTTCGAAGGGCGTTGGCGGAAATTACCGAAGATGCCCGAAGCCGTCGG

GACGGACCCGAGTACCTCACGCAAGATGGCGGAGCTGGAGGAGGTGACTCTGGACGGGAAGCCTCTTCAGGCTCTGCGGGTGACCGACCTGAAGGCCGCA

CTGGAGCAGCGAGGCCTAGCCAAGAGCGGGCAGAAGAGTGCCCTGGTCAAGCGGCTCAAAGGG GCTCTAATGCTAGAAAATTTACAAAAACACTCAACA

CCCCATGCTGCATTCCAGCCAAATTCACAG ATCGGGGAGGAAATGAGCCAGAACAGCTTCATAAAGCAGTATCTGGAAAAGCAGCAGGAGCTACTTAGG

CAGCGCCTGGAACGGGAAGCTCGGGAGGCTGCGGAACTTGAAG AAGCCTCAGCTGAGTCGGAGGACGAGATGACCCATCCTGAGGGAGTGGCTTCCCTG

CTGCCTCCTGATTTTCAGAGCAGCCTGAACAGACCAGAGCTGGAGCTCAGCACACATTCACCCC GAGTGCATTGGATCCCTGGAGCTGGAATTACAGGT

GTTTGA
Translation
MAELEEVTLDGKPLQALRVTDLKAALEQRGLAKSGQKSALVKRLKG ALMLENLQKHSTPHAAFQPNSQ IGEEMSQNSFIKQYLEKQQELLRQRLEREA

REAAELEE EASAESEDEMTHPEGVASLLPPDFQSSLNRPELELSTHSPR RVHWIPGAGITGV
Transcript ENSMUST00000111484
Sequence
ATAGCCGAATATCTCCGATTATGGGTATGCCAGATTCGAGGGCTTCCGAAGAGATTCGATTCAAAGCCCCGGCAAGCCGAAAACAAACGAGCCTGAAAGC

CAGATGGGAGGGGCCAGCCGCTAGGTAGATGGAAAAAGCCGATTGGTACCGATGTGGGGACGGAAACGACCGAACAGCTCCGGAGAAACCCGGGGAATTC

TGAGCGGTAATAGAGGGGTAGACTATGGCAGTGGGCGGGGCCAATCCGGTCCGTTCGAAGGGCGTTGGCGGAAATTACCGAAGATGCCCGAAGCCGTCGG

GACGGACCCGAGTACCTCACGCAAGATGGCGGAGCTGGAGGAGGTGACTCTGGACGGGAAGCCTCTTCAGGCTCTGCGGGTGACCGACCTGAAGGCCGCA

CTGGAGCAGCGAGGCCTAGCCAAGAGCGGGCAGAAGAGTGCCCTGGTCAAGCGGCTCAAAGGG GCTCTAATGCTAGAAAATTTACAAAAACACTCAACA

CCCCATGCTGCATTCCAGCCAAATTCACAG ATCGGGGAGGAAATGAGCCAGAACAGCTTCATAAAGCAGTATCTGGAAAAGCAGCAGGAGCTACTTAGG

CAGCGCCTGGAACGGGAAGCTCGGGAGGCTGCGGAACTTGAAG AAGCCTCAGCTGAGTCGGAGGACGAGATGACCCATCCTGAGGGAGTGGCTTCCCTG

CTGCCTCCTGATTTTCAGAGCAGCCTGAACAGACCAGAGCTGGAGCTCAGCACACATTCACCCC GAAAGAGCTCCTCTTTTTCTGAAGAAAAAGGAGAA

TCTGATGATGAGAAGCCGAGGAAAGGGGAAAGACGATCATCCAGAGTTAGACAG GCAAAATCTAAACTCCCTGAGTACAGTCAGACTGCTGAGGAGGAA

GAGGATCAAGAGACACCATCTAGAAACCTGAGGGTCAGAGCAGATCGAAATTTAAAAATAGAGGAGGAGGAAGAAGAAGAGGAAGAAGAAGAAGATGACG

ATGATGAAGAGGAAGAGGAGGTAGATGAGGCACAGAAATCTAGAGAGGCTGAGGCACCAACCCTGAAGCAGTTTGAGGATGAAGAAGGGGAAGAGAGGAC

CAGAGCAAAACCAGAAAAGGTGGTGGATGAGAAACCCCTAAACATCAGATCCCAGGAAAAGGGTGAGTTAGAGAAAGGAGGGCGAGTTACTAGATCCCAA

GAAGAAGCTAGAAGAAGTCATCTGGCCAGACAGCAACAAGAGAAAGAGACACAAATTGTTTCTCTCCCTCAAGAAGAAAATGAGGTAAAGTCTTCACAAA

GTTTGGAGGAAAAATCCCAGTCTCCCTCCCCACCTCCGCTTCCTGAAGACCTAGAGAAGGCCCCTGTTGTGCTGCAGCCAGAACAGATAGTCAGTGAAGA

GGAAACACCCCCACCTTTACTTACCAAGGAAGCGTCATCTCCACCAACTCATATACAACTCCAGGAAGAGATGGAGCCAGTGGAAGGCCCAGCACCCCCT

GTCCTCATTCAGTTGTCTCCTCCTAACACAGATGCTGGAGCCAGGGAGCCACTAGCGTCTCCTCACCCTGCGCAGCTGCTAAGAAGCCTGTCTCCTTTGT

CAGGTACTACAGACACCAAAGCAGAGTCTCCAGCAGGGAGAGTGTCAGATGAGAGTGTCCTGCCTCTGGCTCAGAAAAGCTCACTGCCTGAATGCTCCAC

CCAGAAGGGTGTTGAAAGTGAGCGTGAAAAGTCTGCTCCCCTCCCTCTAACAGTGGAGGAGTTCGCACCTGCCAAAGGCATCACTGAGGAACCTATGAAG

AAACAGTCTTTGGAACAGAAGGAGGGCAGAAGAGCCTCCCATGCTCTCTTCCCAGAGCACAGTGGGAAGCAGTCAGCCGACTCATCCTCTAGCAGGTCCT

CCTCCCCTTCATCCTCCAGCTCTCCATCCAGATCTCCATCTCCTGACAGTGTGGCTTCCCGCCCACAGTCGTCTCCAGGATCTAAGCAGAGAGATGGAGC

CCAAGCACGAGTTCATGCCAACCCTCACGAGAGACCCAAGATGGGCTCCAGGTCAACTTCAGAGTCCAGGTCACGTTCCCGATCTCGTTCCCGTTCCGCG

TCAAGCAGCAGCAGAAAA TCTCTGAGCCCTGGAGTCTCCAGAGATAGCAACACCAGCTACACTGAAACCAAAGATCCCTCTTGTGGTCAGGAGGCTGCA

GCTCCATCTGGGCCACAGCTGCAGGTCCTTGAACCAAAGGAGAAGGCTCCCACGTTCTCAGCATCTGTCCGGGGGAGGCATCTGAGCCATCCTGAGCCAG

AGCAACAGCACGTGATCCAGAGGTTGCAGCCGGAGCAG - UNI12069 - GGGAGCCCAAAGAAGTGTGAAGCTGAAGAGGCAGAGCCACCAGCTGCC

ACACAGCCTCAAACCTCAGAGACTCAGATCTCTCATCTGCTAGAATCAGAAAGGACTCATCACACTGT - UNI10852 - - UNI23678 - TGAAG

AGAAGGAGGAAGTGACCATGGACACCAGTGAAAACAGACCTGAAAATGAGGTGCCTGAGCCTCCTCTGCCTGTTGCAGACCAAGTCAGCAATGATGAGCG

CCCAGAGGGTGGTGCTGAAGAAGAGGAAAAGAAAGAG - UNI23678 - AGTTCGATGCCCAAGTCATTCAAGAGGAAAATCTCCGTTGTCT - UNI

4309 - CAGCTACCAAGGGGGTGCAAGCTGGAAACAGTGACACAGAGGGGGGCCAGCCTGGCCGAAAACGCCGTTGGGGAGCCAGCACTGCCGCGACAC

AGAAGAAACCGTCCATCAGTATCACCACTGAGTCACTCAAG AGCCTCATCCCCGACATCAAACCCCTGGCGGGGCAGGAGGCTGTTGTGGATCTTCATG

CCGATGACTCCCGAATCTCTGAGGATGAGACAGAGCGTAATGGCGACGATGGGACCCATGACAAGGGACTGAAGATATGCCGGACAGTCACTCAG GTAG

TACCCGCAGAGGGCCAGGAGAATGGGCAGAGGGAAGAGGAAGAAGAGAAAGAGCCTGAAGCCGAGCTGCCGGCGCCACCCCAGGTGTCAGTGGAGGTTGC

CTTGCCCCCACCTGTGGAGCACGAAGTAAAGAAAG TAACATTAGGAGATACCTTAACCCGGAGGTCCATCAGCCAACAGAAGTCTGGAGTTTCCATTAC

AATTGATGACCCAGTCCGGACCGCCCAGGTGCCCTCCCCACCCAGGGGCAAGATCAGTAACATTGTCCACATCTCCAACCTG GTTCGTCCCTTCACTTT

AGGCCAGCTGAAGGAATTATTGGGGCGTACAGGAACTTTGGTGGAAGAGGCCTTCTGGATAGACAAGATCAAATCTCATTGCTTTGTGACG TACTCTAC

AGTAGAGGAAGCCGTTGCCACCCGCACAGCTCTGCACGGGGTCAAGTGGCCCCAG TCCAGCCACCGCCCCACCCCCGGGCTGAGCAGCGGGAGCAGGAA

AGGGCTGTTCGAGAGCAATGGGCAGAACGGGAACGGGAAATGGAGCGCCGGGAGAGGACTCGGTCTGAGAGAGAATGGGATCGGGACAAAGTTCGAGAGG

GACCCCGCTCCCGATCACGGTCCCGTGACCGCCGCCGGAAAGAGCGAGCAAAATCTAAAGAAAAGAAGAGTGAAAAGAAAG AAA
Translation
       - UNI12069 -  - UNI10852 - - UNI23678 - MDTSENRPENEVPEPPLPVADQVSNDERPEGGAEEEEKKE - UNI23678 -

 SSMPKSFKRKISVVS - UNI4309 - SATKGVQAGNSDTEGGQPGRKRRWGASTAATQKKPSISITTESLK SLIPDIKPLAGQEAVVDLHADDSRI

SEDETERNGDDGTHDKGLKICRTVTQ VVPAEGQENGQREEEEEKEPEAELPAPPQVSVEVALPPPVEHEVKKV VTLGDTLTRRSISQQKSGVSITIDD

PVRTAQVPSPPRGKISNIVHISNL VRPFTLGQLKELLGRTGTLVEEAFWIDKIKSHCFVT YSTVEEAVATRTALHGVKWPQ SSHRPTPGLSSGSRKG

LFESNGQNGNGKWSAGRGLGLRENGIGTKFERDPAPDHGPVTAAGKSEQNLKKRRVKRK K
Transcript ENSMUST00000022794
Sequence
ATGATGTTCTCAGACAGCAGAGCAGG - UNI23678 - TGAAGAGAAGGAGGAAGTGACCATGGACACCAGTGAAAACAGACCTGAAAATGAGGTGCC

TGAGCCTCCTCTGCCTGTTGCAGACCAAGTCAGCAATGATGAGCGCCCAGAGGGTGGTGCTGAAGAAGAGGAAAAGAAAGAG - UNI23678 - AGTT

CGATGCCCAAGTCATTCAAGAGGAAAATCTCCGTTGTCT - UNI4309 - CAGCTACCAAGGGGGTGCAAGCTGGAAACAGTGACACAGAGGGGGGCC

AGCCTGGCCGAAAACGCCGTTGGGGAGCCAGCACTGCCGCGACACAGAAGAAACCGTCCATCAGTATCACCACTGAGTCACTCAAG AGCCTCATCCCCG

ACATCAAACCCCTGGCGGGGCAGGAGGCTGTTGTGGATCTTCATGCCGATGACTCCCGAATCTCTGAGGATGAGACAGAGCGTAATGGCGACGATGGGAC

CCATGACAAGGGACTGAAGATATGCCGGACAGTCACTCAG GTAGTACCCGCAGAGGGCCAGGAGAATGGGCAGAGGGAAGAGGAAGAAGAGAAAGAGCC

TGAAGCCGAGCTGCCGGCGCCACCCCAGGTGTCAGTGGAGGTTGCCTTGCCCCCACCTGTGGAGCACGAAGTAAAGAAAG TAACATTAGGAGATACCTT

AACCCGGAGGTCCATCAGCCAACAGAAGTCTGGAGTTTCCATTACAATTGATGACCCAGTCCGGACCGCCCAGGTGCCCTCCCCACCCAGGGGCAAGATC

AGTAACATTGTCCACATCTCCAACCTG GTTCGTCCCTTCACTTTAGGCCAGCTGAAGGAATTATTGGGGCGTACAGGAACTTTGGTGGAAGAGGCCTTC

TGGATAGACAAGATCAAATCTCATTGCTTTGTGACG TACTCTACAGTAGAGGAAGCCGTTGCCACCCGCACAGCTCTGCACGGGGTCAAGTGGCCCCAG

TCCAACCCCAAATTCCTTTGTGCTGACTATGCTGAGCAAGATGAG CTGGACTATCACCGGGGACTCTTGGTAGATCGGCCATCTGAAACTAAGGCAGAG

GAACAGGGAGCACCAAGGCCCCTGCATCCCCCACCCCCACCCCCAGTCCAGCCACCGCCCCACCCCCGGGCTGAGCAGCGGGAGCAGGAAAGGGCTGTTC

GAGAGCAATGGGCAGAACGGGAACGGGAAATGGAGCGCCGGGAGAGGACTCGGTCTGAGAGAGAATGGGATCGGGACAAAGTTCGAGAGGGACCCCGCTC

CCGATCACGGTCCCGTGACCGCCGCCGGAAAGAGCGAGCAAAATCTAAAGAAAAGAAGAGTGAAAAGAAAG AAAAAGCCCAGGAGGAGCCACCTGCCAA

GCTGCTGGATGACCTCTTCCGTAAGACTAAGGCAGCTCCCTGCATCTATTGGCTCCCTCTGACTGAGAGCCAA ATTGTTCAGAAGGAGGCAGAGCAAGC

TGAACGGGCCAAGGAGCGGGAGAAGCGGCGAAAAGAACGAGAAGAAGAAGAACAAAAGGAACGGGAGAAGGAAGCTGAGCGGGAACGGAACCGGCAGCTA

GAACGGGAGAAGAGGAGGGAGCACAGCAGGGAGAGAGAGAGGGACAGGGAGAGAGAGCGGGACAGGGGTGACCGAGAGCGGGAGAGGGAGCGAGACCGAG

ACCGAGGCAGGGAGAGGGATCGCAGAGACACCAAGCGCCACAGCAGAAGCCGGAGTCGAAGCACACCTGTACGGGACCGGGGTGGGCGCCGCTAGCCAAG

AAAACACTAGAGAGCTGCAGGTACCTGCCACTTGGTCCTGGGAGGTCAAAGGCCACAGAGGGATAGGTACAGTCACCACCACCCTGGAACCAAGGGTCTC

ACACCATTGCTCAGTGCTGAACTATAACTGCCACACGTCCCCTCATATCAAATGGAGCAGTGGCAATCTCCCTGTTCCCCAACCTAACTCTTGGAACTTG

GCCCTCTCCTTTCTTCCTGTTAAGTCTGAGAGGGAAGAGCTAGGCTATGAAGGGAAGATGTGGCCGTACGTGGGAATAACCAGTGTCCCACGCTCATTTT

CCCTCCATCCTGCGTTCCGCCTCCCTTGGTACTCAGCCTTTTGGGGACAGCTGGGGCCAGGACTGGGTCACCTATGAGCTGAATCAGCCTCTCCTGAGTC

CCAGGCCCCTGCAGTCCCCTGTTCTCTGGCCTGCAGTCTCTTGCCCGCTGGTTCCACTTTATAGCCACCTTTTCCTTTTGTTCAATTTTTATTTTTATTT

TTTTTATTATTAAATGATGTGGTCTATGGAAAAATAAAAATCTGACTTAGTTTTG
Translation
MMFSDSRAG - UNI23678 - GEEKEEVTMDTSENRPENEVPEPPLPVADQVSNDERPEGGAEEEEKKE - UNI23678 - SSMPKSFKRKISVVS

 - UNI4309 - SATKGVQAGNSDTEGGQPGRKRRWGASTAATQKKPSISITTESLK SLIPDIKPLAGQEAVVDLHADDSRISEDETERNGDDGTHDK

GLKICRTVTQ VVPAEGQENGQREEEEEKEPEAELPAPPQVSVEVALPPPVEHEVKKV VTLGDTLTRRSISQQKSGVSITIDDPVRTAQVPSPPRGKIS

NIVHISNL VRPFTLGQLKELLGRTGTLVEEAFWIDKIKSHCFVT YSTVEEAVATRTALHGVKWPQSNPKFLCADYAEQDE LDYHRGLLVDRPSETKA

EEQGAPRPLHPPPPPPVQPPPHPRAEQREQERAVREQWAEREREMERRERTRSEREWDRDKVREGPRSRSRSRDRRRKERAKSKEKKSEKKE EKAQEEP

PAKLLDDLFRKTKAAPCIYWLPLTESQ IVQKEAEQAERAKEREKRRKEREEEEQKEREKEAERERNRQLEREKRREHSRERERDRERERDRGDRERERE

RDRDRGRERDRRDTKRHSRSRSRSTPVRDRGGRR
Transcript ENSMUST00000111485
Sequence
ATAGCCGAATATCTCCGATTATGGGTATGCCAGATTCGAGGGCTTCCGAAGAGATTCGATTCAAAGCCCCGGCAAGCCGAAAACAAACGAGCCTGAAAGC

CAGATGGGAGGGGCCAGCCGCTAGGTAGATGGAAAAAGCCGATTGGTACCGATGTGGGGACGGAAACGACCGAACAGCTCCGGAGAAACCCGGGGAATTC

TGAGCGGTAATAGAGGGGTAGACTATGGCAGTGGGCGGGGCCAATCCGGTCCGTTCGAAGGGCGTTGGCGGAAATTACCGAAGATGCCCGAAGCCGTCGG

GACGGACCCGAGTACCTCACGCAAGATGGCGGAGCTGGAGGAGGTGACTCTGGACGGGAAGCCTCTTCAGGCTCTGCGGGTGACCGACCTGAAGGCCGCA

CTGGAGCAGCGAGGCCTAGCCAAGAGCGGGCAGAAGAGTGCCCTGGTCAAGCGGCTCAAAGGG GCTCTAATGCTAGAAAATTTACAAAAACACTCAACA

CCCCATGCTGCATTCCAGCCAAATTCACAG ATCGGGGAGGAAATGAGCCAGAACAGCTTCATAAAGCAGTATCTGGAAAAGCAGCAGGAGCTACTTAGG

CAGCGCCTGGAACGGGAAGCTCGGGAGGCTGCGGAACTTGAAG GAAAGAGCTCCTCTTTTTCTGAAGAAAAAGGAGAATCTGATGATGAGAAGCCGAGG

AAAGGGGAAAGACGATCATCCAGAGTTAGACAG GCAAAATCTAAACTCCCTGAGTACAGTCAGACTGCTGAGGAGGAAGAGGATCAAGAGACACCATCT

AGAAACCTGAGGGTCAGAGCAGATCGAAATTTAAAAATAGAGGAGGAGGAAGAAGAAGAGGAAGAAGAAGAAGATGACGATGATGAAGAGGAAGAGGAGG

TAGATGAGGCACAGAAATCTAGAGAGGCTGAGGCACCAACCCTGAAGCAGTTTGAGGATGAAGAAGGGGAAGAGAGGACCAGAGCAAAACCAGAAAAGGT

GGTGGATGAGAAACCCCTAAACATCAGATCCCAGGAAAAGGGTGAGTTAGAGAAAGGAGGGCGAGTTACTAGATCCCAAGAAGAAGCTAGAAGAAGTCAT

CTGGCCAGACAGCAACAAGAGAAAGAGACACAAATTGTTTCTCTCCCTCAAGAAGAAAATGAGGTAAAGTCTTCACAAAGTTTGGAGGAAAAATCCCAGT

CTCCCTCCCCACCTCCGCTTCCTGAAGACCTAGAGAAGGCCCCTGTTGTGCTGCAGCCAGAACAGATAGTCAGTGAAGAGGAAACACCCCCACCTTTACT

TACCAAGGAAGCGTCATCTCCACCAACTCATATACAACTCCAGGAAGAGATGGAGCCAGTGGAAGGCCCAGCACCCCCTGTCCTCATTCAGTTGTCTCCT

CCTAACACAGATGCTGGAGCCAGGGAGCCACTAGCGTCTCCTCACCCTGCGCAGCTGCTAAGAAGCCTGTCTCCTTTGTCAGGTACTACAGACACCAAAG

CAGAGTCTCCAGCAGGGAGAGTGTCAGATGAGAGTGTCCTGCCTCTGGCTCAGAAAAGCTCACTGCCTGAATGCTCCACCCAGAAGGGTGTTGAAAGTGA

GCGTGAAAAGTCTGCTCCCCTCCCTCTAACAGTGGAGGAGTTCGCACCTGCCAAAGGCATCACTGAGGAACCTATGAAGAAACAGTCTTTGGAACAGAAG

GAGGGCAGAAGAGCCTCCCATGCTCTCTTCCCAGAGCACAGTGGGAAGCAGTCAGCCGACTCATCCTCTAGCAGGTCCTCCTCCCCTTCATCCTCCAGCT

CTCCATCCAGATCTCCATCTCCTGACAGTGTGGCTTCCCGCCCACAGTCGTCTCCAGGATCTAAGCAGAGAGATGGAGCCCAAGCACGAGTTCATGCCAA

CCCTCACGAGAGACCCAAGATGGGCTCCAGGTCAACTTCAGAGTCCAGGTCACGTTCCCGATCTCGTTCCCGTTCCGCGTCAAGCAGCAGCAGAAAA TC

TCTGAGCCCTGGAGTCTCCAGAGATAGCAACACCAGCTACACTGAAACCAAAGATCCCTCTTGTGGTCAGGAGGCTGCAGCTCCATCTGGGCCACAGCTG

CAGGTCCTTGAACCAAAGGAGAAGGCTCCCACGTTCTCAGCATCTGTCCGGGGGAGGCATCTGAGCCATCCTGAGCCAGAGCAACAGCACGTGATCCAGA

GGTTGCAGCCGGAGCAG - UNI12069 - GGGAGCCCAAAGAAGTGTGAAGCTGAAGAGGCAGAGCCACCAGCTGCCACACAGCCTCAAACCTCAGAG

ACTCAGATCTCTCATCTGCTAGAATCAGAAAGGACTCATCACACTGT - UNI10852 - - UNI23678 - TGAAGAGAAGGAGGAAGTGACCATGG

ACACCAGTGAAAACAGACCTGAAAATGAGGTGCCTGAGCCTCCTCTGCCTGTTGCAGACCAAGTCAGCAATGATGAGCGCCCAGAGGGTGGTGCTGAAGA

AGAGGAAAAGAAAGAG - UNI23678 - AGTTCGATGCCCAAGTCATTCAAGAGGAAAATCTCCGTTGTCT - UNI4309 - CAGCTACCAAGGGG

GTGCAAGCTGGAAACAGTGACACAGAGGGGGGCCAGCCTGGCCGAAAACGCCGTTGGGGAGCCAGCACTGCCGCGACACAGAAGAAACCGTCCATCAGTA

TCACCACTGAGTCACTCAAG AGCCTCATCCCCGACATCAAACCCCTGGCGGGGCAGGAGGCTGTTGTGGATCTTCATGCCGATGACTCCCGAATCTCTG

AGGATGAGACAGAGCGTAATGGCGACGATGGGACCCATGACAAGGGACTGAAGATATGCCGGACAGTCACTCAG GTAGTACCCGCAGAGGGCCAGGAGA

ATGGGCAGAGGGAAGAGGAAGAAGAGAAAGAGCCTGAAGCCGAGCTGCCGGCGCCACCCCAGGTGTCAGTGGAGGTTGCCTTGCCCCCACCTGTGGAGCA

CGAAGTAAAGAAAG TAACATTAGGAGATACCTTAACCCGGAGGTCCATCAGCCAACAGAAGTCTGGAGTTTCCATTACAATTGATGACCCAGTCCGGAC

CGCCCAGGTGCCCTCCCCACCCAGGGGCAAGATCAGTAACATTGTCCACATCTCCAACCTG GTTCGTCCCTTCACTTTAGGCCAGCTGAAGGAATTATT

GGGGCGTACAGGAACTTTGGTGGAAGAGGCCTTCTGGATAGACAAGATCAAATCTCATTGCTTTGTGACG TACTCTACAGTAGAGGAAGCCGTTGCCAC

CCGCACAGCTCTGCACGGGGTCAAGTGGCCCCAGTCCAACCCCAAATTCCTTTGTGCTGACTATGCTGAGCAAGATGAG CTGGACTATCACCGGGGACT

CTTGGTAGATCGGCCATCTGAAACTAAGGCAGAGGAACAGGGAGCACCAAGGCCCCTGCATCCCCCACCCCCACCCCCAGTCCAGCCACCGCCCCACCCC

CGGGCTGAGCAGCGGGAGCAGGAAAGGGCTGTTCGAGAGCAATGGGCAGAACGGGAACGGGAAATGGAGCGCCGGGAGAGGACTCGGTCTGAGAGAGAAT

GGGATCGGGACAAAGTTCGAGAGGGACCCCGCTCCCGATCACGGTCCCGTGACCGCCGCCGGAAAGAGCGAGCAAAATCTAAAGAAAAGAAGAGTGAAAA

GAAAG AAAAAGCCCAGGAGGAGCCACCTGCCAAGCTGCTGGATGACCTCTTCCGTAAGACTAAGGCAGCTCCCTGCATCTATTGGCTCCCTCTGACTGA

GAGCCAA ATTGTTCAGAAGGAGGCAGAGCAAGCTGAACGGGCCAAGGAGCGGGAGAAGCGGCGAAAAGAACGAGAAGAAGAAGAACAAAAGGAACGGGA

GAAGGAAGCTGAGCGGGAACGGAACCGGCAGCTAGAACGGGAGAAGAGGAGGGAGCACAGCAGGGAGAGAGAGAGGGACAGGGAGAGAGAGCGGGACAGG

GGTGACCGAGAGCGGGAGAGGGAGCGAGACCGAGACCGAGGCAGGGAGAGGGATCGCAGAGACACCAAGCGCCACAGCAGAAGCCGGAGTCGAAGCACAC

CTGTACGGGACCGGGGTGGGCGCCGCTAGCCAAGAAAACACTAGAGAGCTGCAGGTACCTGCCACTTGGTCCTGGGAGGTCAAAGGCCACAGAGGGATAG

GTACAGTCACCACCACCCTGGAACCAAGGGTCTCACACCATTGCTCAGTGCTGAACTATAACTGCCACACGTCCCCTCATATCAAATGGAGCAGTGGCAA

TCTCCCTGTTCCCCAACCTAACTCTTGGAACTTGGCCCTCTCCTTTCTTCCTGTTAAGTCTGAGAGGGAAGAGCTAGGCTATGAAGGGAAGATGTGGCCG

TACGTGGGAATAACCAGTGTCCCACGCTCATTTTCCCTCCATCCTGCGTTCCGCCTCCCTTGGTACTCAGCCTTTTGGGGACAGCTGGGGCCAGGACTGG

GTCACCTATGAGCTGAATCAGCCTCTCCTGAGTCCCAGGCCCCTGCAGTCCCCTGTTCTCTGGCCTGCAGTCTCTTGCCCGCTGGTTCCACTTTATAGCC

ACCTTTTCCTTTTGTTCAATTTTTATTTTTATTTTTTTTATTATTAAATGATGTGGTCTATGGAAAAATAAAAATCTGACTTAGTTTTG
Translation
MWGRKRPNSSGETRGILSGNRGVDYGSGRGQSGPFEGRWRKLPKMPEAVGTDPSTSRKMAELEEVTLDGKPLQALRVTDLKAALEQRGLAKSGQKSALVK

RLKG ALMLENLQKHSTPHAAFQPNSQ IGEEMSQNSFIKQYLEKQQELLRQRLEREAREAAELEG GKSSSFSEEKGESDDEKPRKGERRSSRVRQ AK

SKLPEYSQTAEEEEDQETPSRNLRVRADRNLKIEEEEEEEEEEEDDDDEEEEEVDEAQKSREAEAPTLKQFEDEEGEERTRAKPEKVVDEKPLNIRSQEK

GELEKGGRVTRSQEEARRSHLARQQQEKETQIVSLPQEENEVKSSQSLEEKSQSPSPPPLPEDLEKAPVVLQPEQIVSEEETPPPLLTKEASSPPTHIQL

QEEMEPVEGPAPPVLIQLSPPNTDAGAREPLASPHPAQLLRSLSPLSGTTDTKAESPAGRVSDESVLPLAQKSSLPECSTQKGVESEREKSAPLPLTVEE

FAPAKGITEEPMKKQSLEQKEGRRASHALFPEHSGKQSADSSSSRSSSPSSSSSPSRSPSPDSVASRPQSSPGSKQRDGAQARVHANPHERPKMGSRSTS

ESRSRSRSRSRSASSSSRK SLSPGVSRDSNTSYTETKDPSCGQEAAAPSGPQLQVLEPKEKAPTFSASVRGRHLSHPEPEQQHVIQRLQPEQ - UNI1

2069 - GSPKKCEAEEAEPPAATQPQTSETQISHLLESERTHHTV - UNI10852 - - UNI23678 - VEEKEEVTMDTSENRPENEVPEPPLPV

ADQVSNDERPEGGAEEEEKKE - UNI23678 - SSMPKSFKRKISVVS - UNI4309 - SATKGVQAGNSDTEGGQPGRKRRWGASTAATQKKPSI

SITTESLK SLIPDIKPLAGQEAVVDLHADDSRISEDETERNGDDGTHDKGLKICRTVTQ VVPAEGQENGQREEEEEKEPEAELPAPPQVSVEVALPPP

VEHEVKKV VTLGDTLTRRSISQQKSGVSITIDDPVRTAQVPSPPRGKISNIVHISNL VRPFTLGQLKELLGRTGTLVEEAFWIDKIKSHCFVT YSTV

EEAVATRTALHGVKWPQSNPKFLCADYAEQDE LDYHRGLLVDRPSETKAEEQGAPRPLHPPPPPPVQPPPHPRAEQREQERAVREQWAEREREMERRER

TRSEREWDRDKVREGPRSRSRSRDRRRKERAKSKEKKSEKKE EKAQEEPPAKLLDDLFRKTKAAPCIYWLPLTESQ IVQKEAEQAERAKEREKRRKER

EEEEQKEREKEAERERNRQLEREKRREHSRERERDRERERDRGDRERERERDRDRGRERDRRDTKRHSRSRSRSTPVRDRGGRR
Transcript ENSMUST00000022793
Sequence
ATAGCCGAATATCTCCGATTATGGGTATGCCAGATTCGAGGGCTTCCGAAGAGATTCGATTCAAAGCCCCGGCAAGCCGAAAACAAACGAGCCTGAAAGC

CAGATGGGAGGGGCCAGCCGCTAGGTAGATGGAAAAAGCCGATTGGTACCGATGTGGGGACGGAAACGACCGAACAGCTCCGGAGAAACCCGGGGAATTC

TGAGCGGTAATAGAGGGGTAGACTATGGCAGTGGGCGGGGCCAATCCGGTCCGTTCGAAGGGCGTTGGCGGAAATTACCGAAGATGCCCGAAGCCGTCGG

GACGGACCCGAGTACCTCACGCAAGATGGCGGAGCTGGAGGAGGTGACTCTGGACGGGAAGCCTCTTCAGGCTCTGCGGGTGACCGACCTGAAGGCCGCA

CTGGAGCAGCGAGGCCTAGCCAAGAGCGGGCAGAAGAGTGCCCTGGTCAAGCGGCTCAAAGGG GCTCTAATGCTAGAAAATTTACAAAAACACTCAACA

CCCCATGCTGCATTCCAGCCAAATTCACAG ATCGGGGAGGAAATGAGCCAGAACAGCTTCATAAAGCAGTATCTGGAAAAGCAGCAGGAGCTACTTAGG

CAGCGCCTGGAACGGGAAGCTCGGGAGGCTGCGGAACTTGAAG AAGCCTCAGCTGAGTCGGAGGACGAGATGACCCATCCTGAGGGAGTGGCTTCCCTG

CTGCCTCCTGATTTTCAGAGCAGCCTGAACAGACCAGAGCTGGAGCTCAGCACACATTCACCCC GAAAGAGCTCCTCTTTTTCTGAAGAAAAAGGAGAA

TCTGATGATGAGAAGCCGAGGAAAGGGGAAAGACGATCATCCAGAGTTAGACAG GCAAAATCTAAACTCCCTGAGTACAGTCAGACTGCTGAGGAGGAA

GAGGATCAAGAGACACCATCTAGAAACCTGAGGGTCAGAGCAGATCGAAATTTAAAAATAGAGGAGGAGGAAGAAGAAGAGGAAGAAGAAGAAGATGACG

ATGATGAAGAGGAAGAGGAGGTAGATGAGGCACAGAAATCTAGAGAGGCTGAGGCACCAACCCTGAAGCAGTTTGAGGATGAAGAAGGGGAAGAGAGGAC

CAGAGCAAAACCAGAAAAGGTGGTGGATGAGAAACCCCTAAACATCAGATCCCAGGAAAAGGGTGAGTTAGAGAAAGGAGGGCGAGTTACTAGATCCCAA

GAAGAAGCTAGAAGAAGTCATCTGGCCAGACAGCAACAAGAGAAAGAGACACAAATTGTTTCTCTCCCTCAAGAAGAAAATGAGGTAAAGTCTTCACAAA

GTTTGGAGGAAAAATCCCAGTCTCCCTCCCCACCTCCGCTTCCTGAAGACCTAGAGAAGGCCCCTGTTGTGCTGCAGCCAGAACAGATAGTCAGTGAAGA

GGAAACACCCCCACCTTTACTTACCAAGGAAGCGTCATCTCCACCAACTCATATACAACTCCAGGAAGAGATGGAGCCAGTGGAAGGCCCAGCACCCCCT

GTCCTCATTCAGTTGTCTCCTCCTAACACAGATGCTGGAGCCAGGGAGCCACTAGCGTCTCCTCACCCTGCGCAGCTGCTAAGAAGCCTGTCTCCTTTGT

CAGGTACTACAGACACCAAAGCAGAGTCTCCAGCAGGGAGAGTGTCAGATGAGAGTGTCCTGCCTCTGGCTCAGAAAAGCTCACTGCCTGAATGCTCCAC

CCAGAAGGGTGTTGAAAGTGAGCGTGAAAAGTCTGCTCCCCTCCCTCTAACAGTGGAGGAGTTCGCACCTGCCAAAGGCATCACTGAGGAACCTATGAAG

AAACAGTCTTTGGAACAGAAGGAGGGCAGAAGAGCCTCCCATGCTCTCTTCCCAGAGCACAGTGGGAAGCAGTCAGCCGACTCATCCTCTAGCAGGTCCT

CCTCCCCTTCATCCTCCAGCTCTCCATCCAGATCTCCATCTCCTGACAGTGTGGCTTCCCGCCCACAGTCGTCTCCAGGATCTAAGCAGAGAGATGGAGC

CCAAGCACGAGTTCATGCCAACCCTCACGAGAGACCCAAGATGGGCTCCAGGTCAACTTCAGAGTCCAGGTCACGTTCCCGATCTCGTTCCCGTTCCGCG

TCAAGCAGCAGCAGAAAA TCTCTGAGCCCTGGAGTCTCCAGAGATAGCAACACCAGCTACACTGAAACCAAAGATCCCTCTTGTGGTCAGGAGGCTGCA

GCTCCATCTGGGCCACAGCTGCAGGTCCTTGAACCAAAGGAGAAGGCTCCCACGTTCTCAGCATCTGTCCGGGGGAGGCATCTGAGCCATCCTGAGCCAG

AGCAACAGCACGTGATCCAGAGGTTGCAGCCGGAGCAG - UNI12069 - GGGAGCCCAAAGAAGTGTGAAGCTGAAGAGGCAGAGCCACCAGCTGCC

ACACAGCCTCAAACCTCAGAGACTCAGATCTCTCATCTGCTAGAATCAGAAAGGACTCATCACACTGT - UNI10852 - - UNI23678 - TGAAG

AGAAGGAGGAAGTGACCATGGACACCAGTGAAAACAGACCTGAAAATGAGGTGCCTGAGCCTCCTCTGCCTGTTGCAGACCAAGTCAGCAATGATGAGCG

CCCAGAGGGTGGTGCTGAAGAAGAGGAAAAGAAAGAG - UNI23678 - AGTTCGATGCCCAAGTCATTCAAGAGGAAAATCTCCGTTGTCT - UNI

4309 - CAGCTACCAAGGGGGTGCAAGCTGGAAACAGTGACACAGAGGGGGGCCAGCCTGGCCGAAAACGCCGTTGGGGAGCCAGCACTGCCGCGACAC

AGAAGAAACCGTCCATCAGTATCACCACTGAGTCACTCAAG AGCCTCATCCCCGACATCAAACCCCTGGCGGGGCAGGAGGCTGTTGTGGATCTTCATG

CCGATGACTCCCGAATCTCTGAGGATGAGACAGAGCGTAATGGCGACGATGGGACCCATGACAAGGGACTGAAGATATGCCGGACAGTCACTCAG GTAG

TACCCGCAGAGGGCCAGGAGAATGGGCAGAGGGAAGAGGAAGAAGAGAAAGAGCCTGAAGCCGAGCTGCCGGCGCCACCCCAGGTGTCAGTGGAGGTTGC

CTTGCCCCCACCTGTGGAGCACGAAGTAAAGAAAG TAACATTAGGAGATACCTTAACCCGGAGGTCCATCAGCCAACAGAAGTCTGGAGTTTCCATTAC

AATTGATGACCCAGTCCGGACCGCCCAGGTGCCCTCCCCACCCAGGGGCAAGATCAGTAACATTGTCCACATCTCCAACCTG GTTCGTCCCTTCACTTT

AGGCCAGCTGAAGGAATTATTGGGGCGTACAGGAACTTTGGTGGAAGAGGCCTTCTGGATAGACAAGATCAAATCTCATTGCTTTGTGACG TACTCTAC

AGTAGAGGAAGCCGTTGCCACCCGCACAGCTCTGCACGGGGTCAAGTGGCCCCAGTCCAACCCCAAATTCCTTTGTGCTGACTATGCTGAGCAAGATGAG

 CTGGACTATCACCGGGGACTCTTGGTAGATCGGCCATCTGAAACTAAGGCAGAGGAACAGGGAGCACCAAGGCCCCTGCATCCCCCACCCCCACCCCCA

GTCCAGCCACCGCCCCACCCCCGGGCTGAGCAGCGGGAGCAGGAAAGGGCTGTTCGAGAGCAATGGGCAGAACGGGAACGGGAAATGGAGCGCCGGGAGA

GGACTCGGTCTGAGAGAGAATGGGATCGGGACAAAGTTCGAGAGGGACCCCGCTCCCGATCACGGTCCCGTGACCGCCGCCGGAAAGAGCGAGCAAAATC

TAAAGAAAAGAAGAGTGAAAAGAAAG AAAAAGCCCAGGAGGAGCCACCTGCCAAGCTGCTGGATGACCTCTTCCGTAAGACTAAGGCAGCTCCCTGCAT

CTATTGGCTCCCTCTGACTGAGAGCCAA ATTGTTCAGAAGGAGGCAGAGCAAGCTGAACGGGCCAAGGAGCGGGAGAAGCGGCGAAAAGAACGAGAAGA

AGAAGAACAAAAGGAACGGGAGAAGGAAGCTGAGCGGGAACGGAACCGGCAGCTAGAACGGGAGAAGAGGAGGGAGCACAGCAGGGAGAGAGAGAGGGAC

AGGGAGAGAGAGCGGGACAGGGGTGACCGAGAGCGGGAGAGGGAGCGAGACCGAGACCGAGGCAGGGAGAGGGATCGCAGAGACACCAAGCGCCACAGCA

GAAGCCGGAGTCGAAGCACACCTGTACGGGACCGGGGTGGGCGCCGCTAGCCAAGAAAACACTAGAGAGCTGCAGGTACCTGCCACTTGGTCCTGGGAGG

TCAAAGGCCACAGAGGGATAGGTACAGTCACCACCACCCTGGAACCAAGGGTCTCACACCATTGCTCAGTGCTGAACTATAACTGCCACACGTCCCCTCA

TATCAAATGGAGCAGTGGCAATCTCCCTGTTCCCCAACCTAACTCTTGGAACTTGGCCCTCTCCTTTCTTCCTGTTAAGTCTGAGAGGGAAGAGCTAGGC

TATGAAGGGAAGATGTGGCCGTACGTGGGAATAACCAGTGTCCCACGCTCATTTTCCCTCCATCCTGCGTTCCGCCTCCCTTGGTACTCAGCCTTTTGGG

GACAGCTGGGGCCAGGACTGGGTCACCTATGAGCTGAATCAGCCTCTCCTGAGTCCCAGGCCCCTGCAGTCCCCTGTTCTCTGGCCTGCAGTCTCTTGCC

CGCTGGTTCCACTTTATAGCCACCTTTTCCTTTTGTTCAATTTTTATTTTTATTTTTTTTATTATTAAATGATGTGGTCTATGGAAAAATAAAAATCTGA

CTTAGTTTTG
Translation
MWGRKRPNSSGETRGILSGNRGVDYGSGRGQSGPFEGRWRKLPKMPEAVGTDPSTSRKMAELEEVTLDGKPLQALRVTDLKAALEQRGLAKSGQKSALVK

RLKG ALMLENLQKHSTPHAAFQPNSQ IGEEMSQNSFIKQYLEKQQELLRQRLEREAREAAELEE EASAESEDEMTHPEGVASLLPPDFQSSLNRPEL

ELSTHSPR RKSSSFSEEKGESDDEKPRKGERRSSRVRQ AKSKLPEYSQTAEEEEDQETPSRNLRVRADRNLKIEEEEEEEEEEEDDDDEEEEEVDEAQ

KSREAEAPTLKQFEDEEGEERTRAKPEKVVDEKPLNIRSQEKGELEKGGRVTRSQEEARRSHLARQQQEKETQIVSLPQEENEVKSSQSLEEKSQSPSPP

PLPEDLEKAPVVLQPEQIVSEEETPPPLLTKEASSPPTHIQLQEEMEPVEGPAPPVLIQLSPPNTDAGAREPLASPHPAQLLRSLSPLSGTTDTKAESPA

GRVSDESVLPLAQKSSLPECSTQKGVESEREKSAPLPLTVEEFAPAKGITEEPMKKQSLEQKEGRRASHALFPEHSGKQSADSSSSRSSSPSSSSSPSRS

PSPDSVASRPQSSPGSKQRDGAQARVHANPHERPKMGSRSTSESRSRSRSRSRSASSSSRK SLSPGVSRDSNTSYTETKDPSCGQEAAAPSGPQLQVLE

PKEKAPTFSASVRGRHLSHPEPEQQHVIQRLQPEQ - UNI12069 - GSPKKCEAEEAEPPAATQPQTSETQISHLLESERTHHTV - UNI10852 

- - UNI23678 - VEEKEEVTMDTSENRPENEVPEPPLPVADQVSNDERPEGGAEEEEKKE - UNI23678 - SSMPKSFKRKISVVS - UNI43

09 - SATKGVQAGNSDTEGGQPGRKRRWGASTAATQKKPSISITTESLK SLIPDIKPLAGQEAVVDLHADDSRISEDETERNGDDGTHDKGLKICRTV

TQ VVPAEGQENGQREEEEEKEPEAELPAPPQVSVEVALPPPVEHEVKKV VTLGDTLTRRSISQQKSGVSITIDDPVRTAQVPSPPRGKISNIVHISNL

 VRPFTLGQLKELLGRTGTLVEEAFWIDKIKSHCFVT YSTVEEAVATRTALHGVKWPQSNPKFLCADYAEQDE LDYHRGLLVDRPSETKAEEQGAPRP

LHPPPPPPVQPPPHPRAEQREQERAVREQWAEREREMERRERTRSEREWDRDKVREGPRSRSRSRDRRRKERAKSKEKKSEKKE EKAQEEPPAKLLDDL

FRKTKAAPCIYWLPLTESQ IVQKEAEQAERAKEREKRRKEREEEEQKEREKEAERERNRQLEREKRREHSRERERDRERERDRGDRERERERDRDRGRE

RDRRDTKRHSRSRSRSTPVRDRGGRR

For any suggestions or comments, please send an email to unitrap@crg.es