Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000022201 (Zfr)
Chromosomal location
Chr 15: 12047608 - 12114218 (+)
Description
zinc finger RNA binding protein Gene [Source:MGI Symbol;Acc:MGI:1341890]
RefSeq_peptide
NP_035897.2 
UniGene
Mm.273496 Mm.397284 
MGI
MGI:1341890 
Uniprot/SWISSPROT
O88532 
Uniprot/SPTREMBL
B2RUG7 
Human Ortholog
ENSG00000056097 (ZFR)
Omim not available
UniTrap UNI9021
Vector Insertion
Chr 15: 12047703 - 12047993
Public Clones XH043 (baygenomics) XF255 (baygenomics)
Private Clones OST329610 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI9290
Vector Insertion
Chr 15: 12048094 - 12066150
Public Clones XH045 (baygenomics) W024A02 (ggtc) E055F02 (ggtc) PST17572-NL (escells)
IST14693E6 (tigm) IST14422F10 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 2% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI9534
Vector Insertion
Chr 15: 12067805 - 12070188
Public Clones XE345 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 16% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI5553
Vector Insertion
Chr 15: 12070408 - 12075903
Public Clones YTA148 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 23% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI36410
Vector Insertion
Chr 15: 12076152 - 12079282
Public Clones IST10115G6 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 31% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI20465
Vector Insertion
Chr 15: 12079475 - 12079927
Public Clones not available
Private Clones OST361256 (lexicon) OST103894 (lexicon)
Severity of mutation (?) Insertion after 37% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI9002
Vector Insertion
Chr 15: 12082753 - 12084200
Public Clones XF127 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 52% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI18816
Vector Insertion
Chr 15: 12092020 - 12095899
Public Clones not available
Private Clones OST413684 (lexicon)
Severity of mutation (?) Insertion after 77% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI1628
Vector Insertion
Chr 15: 12101610 - 12110376
Public Clones AY0096 (sanger) CSG400 (baygenomics) XK088 (baygenomics)
Private Clones OST413706 (lexicon)
Severity of mutation (?) Insertion after 88% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000022814
Sequence
GGCAGAGGAGGGAGGCAGCGGGTGAGAGTTCAGAGTTCAGCAGCAGCAGCCCGAGCCCATGATTCCCATATGCCCTGTAGTTTCTTTCACCTATG - UN

I9021 - TGCCCAGCCGGCTGGGGGAAGATGCCAAAATGGCGACCGGCAACTACTTTGGATTCACCCACAGCGGGGCGGCGGCGGCGGCGGCTGCGGCC

CAGTATAG - UNI9290 - CCAGCAGCCAGCTTCGGGTGTAGCCTATTCCCATCCAACTACAGTTGCTAGCTACACTGTCCATCAGGCTCCAGTAGCT

GCTCACACAGTTACTGCTGCTTACGCACCAGCAGCCGCCACAGTTGCAGTTGCCAGGCCTGCTCCAGTTGCTGTTGCAGCTGCTGCAACAGCTGCTGCAT

ATGGAGGCTACCCCACTGCACACACAGCAACCGACTATGGTTACACCCAGAGGCAACAAGAAGCACCACCACCACCACCCCCAGCTACTACACAGAACTA

CCAG GACTCATATTCGTATGTAAGATCCACAGCCCCTGCTGTAGCTTATGATAGTAAGCAGTACTACCAACAGCCAACAGCAACTGCTGCTGCTGTAGC

TGCTGCTGCCCAGCCTCAGCCTTCTGTTGCTGAAACCTACTATCAGACAG - UNI9534 - CCCCTAAAGCAGGTTATAGCCAAGGTGCAACACAGTA

TACTCAAGCGCAGCAAGCTCGGCAAGTGACAGCCATAAAACCAGCCACACCAAGTCCAGCTACCACTACTTTCTCCATTTATCCTGTGTCCTCCACTGTA

CAACCGGTGGCAGCTGCAGCTACTGTGGTACCATCCTATACTCAGAGTGCTACTTACAGTACCACAGCAGTTACTTATTCTG - UNI5553 - GTACA

TCTTATTCAGGTTATGAAGCAGCCGTATATTCAGCTGCGTCTTCCTACTACCAACAGCAGCAGCAACAACAGAAGCAAGCAGCAGCAGCAGCTGCTGCTG

CAGCAGCAACAGCTGCCTGGACAGGGACCACCTTTACTAAAAAAACACCATTCCAAAATAAACAACTGAAACCAAAACAGCCTCCCAAACCACCCCAGAT

TCATTATTGTGATGTTTGTAAGATCAGCTGTGCTGGACCACAG - UNI36410 - ACTTATAAAGAGCACTTAGAAGGACAGAAACATAAAAAAAAGG

AAGCCGCATTGAAAGCCTCTCAAAATACCAGCAGCAGCAACAACTCAACTCGTGGGACACAAAATCAGCTACGTTGCGAGCTCTGTGATGTGTCTTGTAC

AGGAGCAGATGCATATGCTGCCCACATTCGTGGTGCTAAGCATCAGAAA - UNI20465 - GTGGTTAAATTACACACAAAACTTGGTAAACCTATTC

CTTCAACGGAACCAAATGTTGTTAGCCAAGCTACTTCTTCAACAGCTGCATCTGCTTCAAAACCAACTGCCTCTCCTTCAAGTATTGGCGCAAGCAATTG

TACTCTGAACACGTCATCAATTGCAACTTCTTCAGTGAAAGGTCTTTCAACTACAGGAAACTCGTCTCTTAATAGTACATCCAACACTAAAGTGTCAGCG

ATACCTACCAATATGGCTGCCAAGAAAACATCTACACCCAAAATAAACTTTGTTG GTGGAAATAAGCTACAGTCAACAGGAAATAAAACGGAAGACTTA

AAAGGAATTGACTGTGTTAAGAATACTCCTGCTGCCTCTGCTGTGCAGATTCCAGAAGTAAAGCAAGATGCAGGGTCAGAACCAGTCACACCTGCGTCCC

TTGCTGCTCTGCAGAGTGATGTACAACCAGTGGGACATGATTATGTTGAAGAG - UNI9002 - GTACGAAATGATGAAGGAAAAGTCATTCGCTTCC

ATTGTAAATTATGTGAATGCAGCTTTAATGACCCCAATGCTAAAGAGATGCACCTAAAAGGACGAAGACATAGACTTCAGTATAAA AAAAAAGTAAATC

CAGATTTGCAAGTAGAAGTGAAGCCCAGTATTCGTGCCAGAAAAATTCAAGAAGAGAAAATGAGAAAGCAAATGCAGAAGGAGGAATATTGGCGGAGACG

AGAAGAGGAGGAACGCTGGAGGATGGAGATAAG ACGTTATGAAGAAGACATGTACTGGAGAAGAATGGAGGAAGAGCAGCATCATTGGGATGATCGCAG

ACGAATGCCTGATGGCGGCTATCCTCATGGTCCTCCCGGCCCACTAGGTCTTTTGGGAGTCCGACCAGGCATGCCTCCCCAGCCGCAGGGTCCTGCC CC

CTTACGGCGTCCTGACTCATCTGATGATCGTTATGTAATGACAAAGCATGCAACTATTTATCCAACTGAAGAAGAGTTACAAGCCGTCCAGAAAATTGTT

TCTATCACTGAGCGTGCTTTAAAGCTTGTTTCAGACAGTTTGTCGGAACATGAGAAGAGCAAGAACAAAGAGGGAGATGATAAGAAAGAGGGAGGTAAAG

ACAG AGCTCTGAAAGGGGTGTTGCGAGTAGGCGTGCTGGCAAAAGGATTACTTCTCCGAGGAGACAGGAATGTCAACCTTGTTTTGCTGTGCTCAGAAA

AACCTTCAAAGTCGTTATTAAGCCGTATTGCAGAAAACCTACCCAAACAGCTTGCT - UNI18816 - GTTATAAGTCCTGAGAAGTATGACATAAAA

TGTGCCGTGTCTGAGGCAGCGATAATTTTGAACTCGTGTGTGGAGCCCAAAATGCAAGTCACTATCACCCTGACATCTCCAATTATTCGAGAAGAGAACA

TGAGGGAAGGAG ATGTAACCTCGGGTATGGTGAAAGACCCACCGGACGTCTTGGACAGGCAAAAATGCCTTGACGCTCTGGCTGCTCTACGCCACGCTA

AGTGGTTCCAG GCTAGAGCTAATGGCCTACAGTCGTGTGTGATTATCATACGTATTCTCCGAGACCTTTGTCAACGAGTTCCAACGTGGTCTGATTTTC

CTAGCTGG - UNI1628 - GCTATGGAGTTACTGGTGGAGAAGGCAATTAGCAGTGCTTCTAGTCCTCAAAGCCCTGGAGATGCCCTGAGAAGAGTAT

TTGAGTGCATTTCTTCAGGGATTATTCTCAAAG GCAGCCCTGGACTTCTGGACCCTTGTGAAAAGGATCCCTTTGACACTTTGGCAACAATGACTGACC

AACAGCGTGAAGACATTACATCCAGTGCACAG TTTGCATTGAGACTCCTTGCATTCCGTCAGATACACAAAGTTCTGGGGATGGATCCATTACCACAAA

TGAATCAGCGCTTTAACATCCACAACAACAGGAAACGAAGAAGGGATAGTGATGGAGTGGATGGATTTGAAGCTGAGGGGAAGAAAGACAAAAAGGATTA

TGATAACTTTTAAAAAGTTTGTGTAAATCTTCAGTGTTACAGTAGGTGCCGGTTTATTGGCTGTTTTCCATTCATATTAATCTCTACTTTAAAAGTTTAT

CAAGAGTATAAAGAGTTTCATGGAAGAACCAAGTTTTTCTATGATTAAAAACTTATTGTACAGTGTCAGGTATTATATGGATGGAAAGAAAGAGATTTGA

CTAGGGGGAATATATTGGTCTTTCCCCCCCCCCACCCTTTTTCATTATTTTGATTTTATTGACTGGTTGCCCTTACTCCCTGTATTTTTGTGTCTTTTAT

TAACTAGTGCATTGTGTTATTAAATCTTTTCTGTATGT
Translation
 - UNI9021 - MATGNYFGFTHSGAAAAAAAAQYS - UNI9290 - SQQPASGVAYSHPTTVASYTVHQAPVAAHTVTAAYAPAAATVAVARPAPV

AVAAAATAAAYGGYPTAHTATDYGYTQRQQEAPPPPPPATTQNYQ DSYSYVRSTAPAVAYDSKQYYQQPTATAAAVAAAAQPQPSVAETYYQTA - UN

I9534 - APKAGYSQGATQYTQAQQARQVTAIKPATPSPATTTFSIYPVSSTVQPVAAAATVVPSYTQSATYSTTAVTYSG - UNI5553 - GTSYS

GYEAAVYSAASSYYQQQQQQQKQAAAAAAAAAATAAWTGTTFTKKTPFQNKQLKPKQPPKPPQIHYCDVCKISCAGPQ - UNI36410 - TYKEHLEG

QKHKKKEAALKASQNTSSSNNSTRGTQNQLRCELCDVSCTGADAYAAHIRGAKHQK - UNI20465 - VVKLHTKLGKPIPSTEPNVVSQATSSTAAS

ASKPTASPSSIGASNCTLNTSSIATSSVKGLSTTGNSSLNSTSNTKVSAIPTNMAAKKTSTPKINFVG GGNKLQSTGNKTEDLKGIDCVKNTPAASAVQ

IPEVKQDAGSEPVTPASLAALQSDVQPVGHDYVEE - UNI9002 - VRNDEGKVIRFHCKLCECSFNDPNAKEMHLKGRRHRLQYK KKVNPDLQVEV

KPSIRARKIQEEKMRKQMQKEEYWRRREEEERWRMEIR RRYEEDMYWRRMEEEQHHWDDRRRMPDGGYPHGPPGPLGLLGVRPGMPPQPQGPA PLRRP

DSSDDRYVMTKHATIYPTEEELQAVQKIVSITERALKLVSDSLSEHEKSKNKEGDDKKEGGKDR RALKGVLRVGVLAKGLLLRGDRNVNLVLLCSEKPS

KSLLSRIAENLPKQLA - UNI18816 - VISPEKYDIKCAVSEAAIILNSCVEPKMQVTITLTSPIIREENMREGD DVTSGMVKDPPDVLDRQKCLD

ALAALRHAKWFQ ARANGLQSCVIIIRILRDLCQRVPTWSDFPSW - UNI1628 - AMELLVEKAISSASSPQSPGDALRRVFECISSGIILKG GSP

GLLDPCEKDPFDTLATMTDQQREDITSSAQ FALRLLAFRQIHKVLGMDPLPQMNQRFNIHNNRKRRRDSDGVDGFEAEGKKDKKDYDNF

For any suggestions or comments, please send an email to unitrap@crg.es