Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000022253 (1110020G09Rik)
Chromosomal location
Chr 15: 9001009 - 9039895 (+)
Description
RIKEN cDNA 1110020G09 gene Gene [Source:MGI Symbol;Acc:MGI:1915896]
RefSeq_peptide
NP_001035485.2 NP_001078879.1 
UniGene
Mm.423642 Mm.244226 
MGI
MGI:1915896 
Uniprot/SWISSPROT
Q8C5H8 
Uniprot/SPTREMBL
Q14BL1 Q9CUB4 
Human Ortholog
ENSG00000152620 (C5orf33)
Omim not available
UniTrap UNI30200
Vector Insertion
Chr 15: 9001515 - 9013018
Public Clones D081C01 (ggtc)
Private Clones not available
Severity of mutation (?) Insertion after 19% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI24358
Vector Insertion
Chr 15: 9014000 - 9015473
Public Clones not available
Private Clones OST223714 (lexicon)
Severity of mutation (?) Insertion after 32% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI17289
Vector Insertion
Chr 15: 9015556 - 9020923
Public Clones not available
Private Clones OST445892 (lexicon)
Severity of mutation (?) Insertion after 38% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI18371
Vector Insertion
Chr 15: 9022609 - 9025771
Public Clones IST12979D10 (tigm) IST11501C8 (tigm)
Private Clones OST424717 (lexicon)
Severity of mutation (?) Insertion after 55% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000100789
Sequence
GAGAGGCCACTGCGCAGGCGCCCAAGAAAACGGATAAACAAACAAATAAAACCCACTGCCCGGGGGCCAGCCCGGATCCCCGCCTCCCGGGGCCTCCCGG

GGCCTCTCCGCCCTCGCGTGCGTCTGGGCACGTCCCCCCCCCCCCCGGCGCGTTCCACGCACGTCCCCGCACTTAACCTGTGCGCGGCCGGCGCGGTGCT

GGCGGCAGGGAGCGCGAGCCTGCACCCGCGGCCCCGCGGATCATGACTTGCTACCGGGGCTTCCTGCTGGGCAGCTGCCGGCGCGTGGCGGGTGGCCGCG

CGGCTCTGCGGGGTTCGGGCTCGGGCGCGGACGGCCGGCGGCACTTGGGGCACGGGCAGCCGCGCGAGCTGGCGGGCGGTGGTAGCCCCGCCGACGGCGG

CTTCCGCCCCTCGCGGGTGGTGGTGGTGGCGAAAACCACCCGCTACGAGTTCGAGCAGCAGCGGTACCGCTACGCGGAGCTCTCGGAGGAGGACCTGAAG

CAGCTG - UNI30200 - CTTGCATTGAAAGGCTCGAGCTACAGTGGACTACTTGAGCGACATCATATTCACACCAAAAATGTAGAACACATAATTGA

TAGTTTACG GGATGAAGGGATTGAGGTTCGCCTGGTCAAGCGGAGGGAGTACGATGAAGAGACAGTTCGATGGGCAGACGCTGTCATAGCTGCGGGAG 

- UNI24358 - GTGATGGCACGATGCTTCTGGCTGCGAGTAAAGTCCTGGACAGACTTAAACCTGTCATTGGGGTCAACACTGATCCGGAACG - UN

I17289 - GTGGTTGTGGAGGCAGCGGATCAGGTTATATCTGGAAGGGACTGGCATAAACCCCACTCCCGTGGACCTTCACGAACAGCAGCTGAGCTTG

AATCAGCACAGCCGAGCCTTTAACATCGAAAGAGCGCACGATGAAA - UNI18371 - GGTCGGAGGCGTCAGGGCCTCAGCTTCTGCCGGTGAGAGC

GCTCAATGAAGTCTTCATTGGGGAGAGCCTGTCATCCAG GGCTTCCTACTATGAAATTTCAGTCGATGACGGCCCATGGGAGAAGCAGAAGAGCTCAGG

GCTCAATTTGTGCACTGGGACAGGATCGAAGGCCTG GTCATTCAATATTAACAGGGTTGCAGCGCAGGCTGTTGAAGATGTTTTACATATTG CAAGAC

GACAAGGAAATCTGACTCTTCCATTGAACAAAGACTTGGTAGAAAAAG TGACAAACGAATATAACGAATCATTGCTCTACAGTCCAGAAGAACCAAAAA

TACTTTTCAGTATTCGAGAGCCAATAGCAAACAGAGTTTTCTCCAGCAGCCGTCAGCGTTGTTTCTCTTCCAA AGTTTGTGTTCGTTCTCGATGTTGGG

ATGCCTGCATGGTTGTGGATGGAGGAACGTCTTTTGAGTTTAACGACGGAGCAATTGCTTCAATGATGATCAATAAAGAAGATGAGCTTCGAACTGTGAT

TCTAGAGCAGTGAAGGGCGTCCTCAGGCGCTGCATGCGATTAGTAGGCATTTTTTTCTGCAGATACAGATGACCAGCCATGCACCGACCTTGTTAGGATT

CTTAATGACAGGCTACCACTAGAGTCAAGGTGACAAAATGGGACGCGTGTGCTCTCCTGCTGATTCTGACAGACAAGAGCTGTTCACCGTGAGACGGACT

AAATGGACTAGAATTATGTCAAAGCTTCTGTATTATTTACAGTTGGTAACCAAGAGCATTGATACTCTTTAGAGGCAGGTTAAATAAAGGATTAAGTATT

TAGGATTTGAAATTTAACTGTACAAGTGTTGTTTTCTTCCTAACTTTGTGGAATTGGCCATGTGTATCAGTTGATTAGTACATTATTTTTATAGTACTTA

AAAGTAAAGATTTAAAAAAATTTTTGATGATGGAGAATTTTGATAAATCCTGATGTTGACTTAACTGAAGTTGGTAAATGTGTTTTCTATAGCTAAGAAT

TTTCTAATTCTAGGAAACCATGATGGAATCACTATTGATTGAAACCATGGGAACAGATTATTTGTAGACAAATTCTGACTTGTTTTGGGTGTCATCAGTG

CTAGATGAAACACATCTATGGGACATGTCATTGACACTTTGTAAAGTATTAATTTCCATAGCAATTATTGTTCAGACAAGTAACTGAGTCCGATAGCCCC

TTTCCTGATTTTGGTTTTGGATTTCTATTATGAAATCAAGGATTAGAAGGATAATCAATGATTGTGCTCTGTTCAGTAAAATGTTCAAAGACCCTTCCTT

TAGTATTGGGCATGGACTCTAGTAAACACCTGGGACTTAAGACAGAATTTTGGAATTGCCTTAAATTAGTATTGTGATTTCCATTTCCTGTATTCTAAAA

TTTAAACAATAGCTTTGCGGGATGAACAGCTTCCCCATCTTCCGGTATGAAAACCACTCTTAGTTTTGGAGAAAACTATTTTAATTCTTGATTTTGTTTT

CATGAAAAGCTTCTCCATTGCTAGATAATGGATGGTATTTTCATGCTGGGTTTTTCAGACTTGTGCATTTTCAGTTGTTGGTGAACTTCCTTTTTTATTG

ACAATATGAAGACTCATTCTGTGCCATCTACCATATAAGTATATATCTGTATCATGTTATAGATATATATGATATAATGAATTGTTGCATAGACATCGAA

ATAGACCGTTTATGGAACTTGAGCTTCGTGAGCTCAGAAGTAAAAAACTAAAGCTAGGATGTATGATGAGATCAAATGCTCTTAGCTTTGCCAAACGCAA

CACGCTGCTCTTTAACAATTAAGAAAAATGAATGTCACTGTGTGAGGTAATTTAGATCTGTCTGGGTTTGTGTGTTTATTTAGAACATTTCCCTTGACTA

TAGAAGGAAATAAGTGTTTTTATCTGAGCCAACTCTAATTTCTAGTTTAACTTTTTTTTTTTTTTTAAATGGATATATTTAAGATATCCCTTTATATGAA

AGTTAAATACCTTGTTAGAAAAAAAATGCCACTCTCATCTTTAATGTACCTAGATCTGGTTGTCCATGATTTACCACACATCTATTTATACGTACCACTA

ATTGGTAATGAGCTGTGTGAAATCGTTCTTAAACTACCCTTGGAAAGGTATTAAAATTACTTATTATGCTCTGCCTACAATCTAACTTCTACTCTGTGGC

AGGCAGGGATTTATTTGTAATAGACTAATGGCAAAGGATGTTGGAATATCAAAAATGTCTTTAAATGGGTTAACCTTTAATGACCACTTTATGC
Translation
 - UNI30200 -   - UNI24358 - MLLAASKVLDRLKPVIGVNTDPER - UNI17289 - RWLWRQRIRLYLEGTGINPTPVDLHEQQLSLNQ

HSRAFNIERAHDER - UNI18371 - RSEASGPQLLPVRALNEVFIGESLSSR RASYYEISVDDGPWEKQKSSGLNLCTGTGSKAW WSFNINRVAA

QAVEDVLHIA ARRQGNLTLPLNKDLVEKV VTNEYNESLLYSPEEPKILFSIREPIANRVFSSSRQRCFSSK KVCVRSRCWDACMVVDGGTSFEFNDG

AIASMMINKEDELRTVILEQ
Transcript ENSMUST00000100790
Sequence
GAGAGGCCACTGCGCAGGCGCCCAAGAAAACGGATAAACAAACAAATAAAACCCACTGCCCGGGGGCCAGCCCGGATCCCCGCCTCCCGGGGCCTCCCGG

GGCCTCTCCGCCCTCGCGTGCGTCTGGGCACGTCCCCCCCCCCCCCGGCGCGTTCCACGCACGTCCCCGCACTTAACCTGTGCGCGGCCGGCGCGGTGCT

GGCGGCAGGGAGCGCGAGCCTGCACCCGCGGCCCCGCGGATCATGACTTGCTACCGGGGCTTCCTGCTGGGCAGCTGCCGGCGCGTGGCGGGTGGCCGCG

CGGCTCTGCGGGGTTCGGGCTCGGGCGCGGACGGCCGGCGGCACTTGGGGCACGGGCAGCCGCGCGAGCTGGCGGGCGGTGGTAGCCCCGCCGACGGCGG

CTTCCGCCCCTCGCGGGTGGTGGTGGTGGCGAAAACCACCCGCTACGAGTTCGAGCAGCAGCGGTACCGCTACGCGGAGCTCTCGGAGGAGGACCTGAAG

CAGCTG - UNI30200 - CTTGCATTGAAAGGCTCGAGCTACAGTGGACTACTTGAGCGACATCATATTCACACCAAAAATGTAGAACACATAATTGA

TAGTTTACG GGATGAAGGGATTGAGGTTCGCCTGGTCAAGCGGAGGGAGTACGATGAAGAGACAGTTCGATGGGCAGACGCTGTCATAGCTGCGGGAG 

- UNI24358 - GTGATGGCACGATGCTTCTGGCTGCGAGTAAAGTCCTGGACAGACTTAAACCTGTCATTGGGGTCAACACTGATCCGGAACG - UN

I17289 - GTCTGAAGGTCACTTATGTCTGCCTGTGCGATACACGCATTCCTTCCCTGAAGCCTTACGGAGGTTCTCTCGTGGTGAGTTCAG GTGGTT

GTGGAGGCAGCGGATCAGGTTATATCTGGAAGGGACTGGCATAAACCCCACTCCCGTGGACCTTCACGAACAGCAGCTGAGCTTGAATCAGCACAGCCGA

GCCTTTAACATCGAAAGAGCGCACGATGAAA - UNI18371 - GGTCGGAGGCGTCAGGGCCTCAGCTTCTGCCGGTGAGAGCGCTCAATGAAGTCTT

CATTGGGGAGAGCCTGTCATCCAG GGCTTCCTACTATGAAATTTCAGTCGATGACGGCCCATGGGAGAAGCAGAAGAGCTCAGGGCTCAATTTGTGCAC

TGGGACAGGATCGAAGGCCTG GTCATTCAATATTAACAGGGTTGCAGCGCAGGCTGTTGAAGATGTTTTACATATTG CAAGACGACAAGGAAATCTGA

CTCTTCCATTGAACAAAGACTTGGTAGAAAAAG TGACAAACGAATATAACGAATCATTGCTCTACAGTCCAGAAGAACCAAAAATACTTTTCAGTATTC

GAGAGCCAATAGCAAACAGAGTTTTCTCCAGCAGCCGTCAGCGTTGTTTCTCTTCCAA AGTTTGTGTTCGTTCTCGATGTTGGGATGCCTGCATGGTTG

TGGATGGAGGAACGTCTTTTGAGTTTAACGACGGAGCAATTGCTTCAATGATGATCAATAAAGAAGATGAGCTTCGAACTGTGATTCTAGAGCAGTGAAG

GGCGTCCTCAGGCGCTGCATGCGATTAGTAGGCATTTTTTTCTGCAGATACAGATGACCAGCCATGCACCGACCTTGTTAGGATTCTTAATGACAGGCTA

CCACTAGAGTCAAGGTGACAAAATGGGACGCGTGTGCTCTCCTGCTGATTCTGACAGACAAGAGCTGTTCACCGTGAGACGGACTAAATGGACTAGAATT

ATGTCAAAGCTTCTGTATTATTTACAGTTGGTAACCAAGAGCATTGATACTCTTTAGAGGCAGGTTAAATAAAGGATTAAGTATTTAGGATTTGAAATTT

AACTGTACAAGTGTTGTTTTCTTCCTAACTTTGTGGAATTGGCCATGTGTATCAGTTGATTAGTACATTATTTTTATAGTACTTAAAAGTAAAGATTTAA

AAAAATTTTTGATGATGGAGAATTTTGATAAATCCTGATGTTGACTTAACTGAAGTTGGTAAATGTGTTTTCTATAGCTAAGAATTTTCTAATTCTAGGA

AACCATGATGGAATCACTATTGATTGAAACCATGGGAACAGATTATTTGTAGACAAATTCTGACTTGTTTTGGGTGTCATCAGTGCTAGATGAAACACAT

CTATGGGACATGTCATTGACACTTTGTAAAGTATTAATTTCCATAGCAATTATTGTTCAGACAAGTAACTGAGTCCGATAGCCCCTTTCCTGATTTTGGT

TTTGGATTTCTATTATGAAATCAAGGATTAGAAGGATAATCAATGATTGTGCTCTGTTCAGTAAAATGTTCAAAGACCCTTCCTTTAGTATTGGGCATGG

ACTCTAGTAAACACCTGGGACTTAAGACAGAATTTTGGAATTGCCTTAAATTAGTATTGTGATTTCCATTTCCTGTATTCTAAAATTTAAACAATAGCTT

TGCGGGATGAACAGCTTCCCCATCTTCCGGTATGAAAACCACTCTTAGTTTTGGAGAAAACTATTTTAATTCTTGATTTTGTTTTCATGAAAAGCTTCTC

CATTGCTAGATAATGGATGGTATTTTCATGCTGGGTTTTTCAGACTTGTGCATTTTCAGTTGTTGGTGAACTTCCTTTTTTATTGACAATATGAAGACTC

ATTCTGTGCCATCTACCATATAAGTATATATCTGTATCATGTTATAGATATATATGATATAATGAATTGTTGCATAGACATCGAAATAGACCGTTTATGG

AACTTGAGCTTCGTGAGCTCAGAAGTAAAAAACTAAAGCTAGGATGTATGATGAGATCAAATGCTCTTAGCTTTGCCAAACGCAACACGCTGCTCTTTAA

CAATTAAGAAAAATGAATGTCACTGTGTGAGGTAATTTAGATCTGTCTGGGTTTGTGTGTTTATTTAGAACATTTCCCTTGACTATAGAAGGAAATAAGT

GTTTTTATCTGAGCCAACTCTAATTTCTAGTTTAACTTTTTTTTTTTTTTTAAATGGATATATTTAAGATATCCCTTTATATGAAAGTTAAATACCTTGT

TAGAAAAAAAATGCCACTCTCATCTTTAATGTACCTAGATCTGGTTGTCCATGATTTACCACACATCTATTTATACGTACCACTAATTGGTAATGAGCTG

TGTGAAATCGTTCTTAAACTACCCTTGGAAAGGTATTAAAATTACTTATTATGCTCTGCCTACAATCTAACTTCTACTCTGTGGCAGGCAGGGATTTATT

TGTAATAGACTAATGGCAAAGGATGTTGGAATATCAAAAATGTCTTTAAATGGGTTAACCTTTAATGACCACTTTATGC
Translation
 - UNI30200 -   - UNI24358 - MLLAASKVLDRLKPVIGVNTDPER - UNI17289 - RSEGHLCLPVRYTHSFPEALRRFSRGEFR RWL

WRQRIRLYLEGTGINPTPVDLHEQQLSLNQHSRAFNIERAHDER - UNI18371 - RSEASGPQLLPVRALNEVFIGESLSSR RASYYEISVDDGPW

EKQKSSGLNLCTGTGSKAW WSFNINRVAAQAVEDVLHIA ARRQGNLTLPLNKDLVEKV VTNEYNESLLYSPEEPKILFSIREPIANRVFSSSRQRCF

SSK KVCVRSRCWDACMVVDGGTSFEFNDGAIASMMINKEDELRTVILEQ
Transcript ENSMUST00000067760
Sequence
GAGAGGCCACTGCGCAGGCGCCCAAGAAAACGGATAAACAAACAAATAAAACCCACTGCCCGGGGGCCAGCCCGGATCCCCGCCTCCCGGGGCCTCCCGG

GGCCTCTCCGCCCTCGCGTGCGTCTGGGCACGTCCCCCCCCCCCCCGGCGCGTTCCACGCACGTCCCCGCACTTAACCTGTGCGCGGCCGGCGCGGTGCT

GGCGGCAGGGAGCGCGAGCCTGCACCCGCGGCCCCGCGGATCATGACTTGCTACCGGGGCTTCCTGCTGGGCAGCTGCCGGCGCGTGGCGGGTGGCCGCG

CGGCTCTGCGGGGTTCGGGCTCGGGCGCGGACGGCCGGCGGCACTTGGGGCACGGGCAGCCGCGCGAGCTGGCGGGCGGTGGTAGCCCCGCCGACGGCGG

CTTCCGCCCCTCGCGGGTGGTGGTGGTGGCGAAAACCACCCGCTACGAGTTCGAGCAGCAGCGGTACCGCTACGCGGAGCTCTCGGAGGAGGACCTGAAG

CAGCTG - UNI30200 - CTTGCATTGAAAGGCTCGAGCTACAGTGGACTACTTGAGCGACATCATATTCACACCAAAAATGTAGAACACATAATTGA

TAGTTTACG GGATGAAGGGATTGAGGTTCGCCTGGTCAAGCGGAGGGAGTACGATGAAGAGACAGTTCGATGGGCAGACGCTGTCATAGCTGCGGGAG 

- UNI24358 - GTGATGGCACGATGCTTCTGGCTGCGAGTAAAGTCCTGGACAGACTTAAACCTGTCATTGGGGTCAACACTGATCCGGAACG - UN

I17289 - GTCTGAAGGTCACTTATGTCTGCCTGTGCGATACACGCATTCCTTCCCTGAAGCCTTACGGAGGTTCTCTCGTGGTGAGTTCAG GTGGTT

GTGGAGGCAGCGGATCAGGTTATATCTGGAAGGGACTGGCATAAACCCCACTCCCGTGGACCTTCACGAACAGCAGCTGAGCTTGAATCAGCACAGCCGA

GCCTTTAACATCGAAAGAGCGCACGATGAAA - UNI18371 - GGTCGGAGGCGTCAGGGCCTCAGCTTCTGCCGGTGAGAGCGCTCAATGAAGTCTT

CATTGGGGAGAGCCTGTCATCCAG AATGCCTTATTGTTGGGCTGTAGCAGTGGACAATTTAAGAAGAGATATACCCAATCTAAAGGGACT GGCTTCCT

ACTATGAAATTTCAGTCGATGACGGCCCATGGGAGAAGCAGAAGAGCTCAGGGCTCAATTTGTGCACTGGGACAGGATCGAAGGCCTG GTCATTCAATA

TTAACAGGGTTGCAGCGCAGGCTGTTGAAGATGTTTTACATATTG CAAGACGACAAGGAAATCTGACTCTTCCATTGAACAAAGACTTGGTAGAAAAAG

 TGACAAACGAATATAACGAATCATTGCTCTACAGTCCAGAAGAACCAAAAATACTTTTCAGTATTCGAGAGCCAATAGCAAACAGAGTTTTCTCCAGCA

GCCGTCAGCGTTGTTTCTCTTCCAA AGTTTGTGTTCGTTCTCGATGTTGGGATGCCTGCATGGTTGTGGATGGAGGAACGTCTTTTGAGTTTAACGACG

GAGCAATTGCTTCAATGATGATCAATAAAGAAGATGAGCTTCGAACTGTGATTCTAGAGCAGTGAAGGGCGTCCTCAGGCGCTGCATGCGATTAGTAGGC

ATTTTTTTCTGCAGATACAGATGACCAGCCATGCACCGACCTTGTTAGGATTCTTAATGACAGGCTACCACTAGAGTCAAGGTGACAAAATGGGACGCGT

GTGCTCTCCTGCTGATTCTGACAGACAAGAGCTGTTCACCGTGAGACGGACTAAATGGACTAGAATTATGTCAAAGCTTCTGTATTATTTACAGTTGGTA

ACCAAGAGCATTGATACTCTTTAGAGGCAGGTTAAATAAAGGATTAAGTATTTAGGATTTGAAATTTAACTGTACAAGTGTTGTTTTCTTCCTAACTTTG

TGGAATTGGCCATGTGTATCAGTTGATTAGTACATTATTTTTATAGTACTTAAAAGTAAAGATTTAAAAAAATTTTTGATGATGGAGAATTTTGATAAAT

CCTGATGTTGACTTAACTGAAGTTGGTAAATGTGTTTTCTATAGCTAAGAATTTTCTAATTCTAGGAAACCATGATGGAATCACTATTGATTGAAACCAT

GGGAACAGATTATTTGTAGACAAATTCTGACTTGTTTTGGGTGTCATCAGTGCTAGATGAAACACATCTATGGGACATGTCATTGACACTTTGTAAAGTA

TTAATTTCCATAGCAATTATTGTTCAGACAAGTAACTGAGTCCGATAGCCCCTTTCCTGATTTTGGTTTTGGATTTCTATTATGAAATCAAGGATTAGAA

GGATAATCAATGATTGTGCTCTGTTCAGTAAAATGTTCAAAGACCCTTCCTTTAGTATTGGGCATGGACTCTAGTAAACACCTGGGACTTAAGACAGAAT

TTTGGAATTGCCTTAAATTAGTATTGTGATTTCCATTTCCTGTATTCTAAAATTTAAACAATAGCTTTGCGGGATGAACAGCTTCCCCATCTTCCGGTAT

GAAAACCACTCTTAGTTTTGGAGAAAACTATTTTAATTCTTGATTTTGTTTTCATGAAAAGCTTCTCCATTGCTAGATAATGGATGGTATTTTCATGCTG

GGTTTTTCAGACTTGTGCATTTTCAGTTGTTGGTGAACTTCCTTTTTTATTGACAATATGAAGACTCATTCTGTGCCATCTACCATATAAGTATATATCT

GTATCATGTTATAGATATATATGATATAATGAATTGTTGCATAGACATCGAAATAGACCGTTTATGGAACTTGAGCTTCGTGAGCTCAGAAGTAAAAAAC

TAAAGCTAGGATGTATGATGAGATCAAATGCTCTTAGCTTTGCCAAACGCAACACGCTGCTCTTTAACAATTAAGAAAAATGAATGTCACTGTGTGAGGT

AATTTAGATCTGTCTGGGTTTGTGTGTTTATTTAGAACATTTCCCTTGACTATAGAAGGAAATAAGTGTTTTTATCTGAGCCAACTCTAATTTCTAGTTT

AACTTTTTTTTTTTTTTTAAATGGATATATTTAAGATATCCCTTTATATGAAAGTTAAATACCTTGTTAGAAAAAAAATGCCACTCTCATCTTTAATGTA

CCTAGATCTGGTTGTCCATGATTTACCACACATCTATTTATACGTACCACTAATTGGTAATGAGCTGTGTGAAATCGTTCTTAAACTACCCTTGGAAAGG

TATTAAAATTACTTATTATGCTCTGCCTACAATCTAACTTCTACTCTGTGGCAGGCAGGGATTTATTTGTAATAGACTAATGGCAAAGGATGTTGGAATA

TCAAAAATGTCTTTAAATGGGTTAACCTTTAATGACCACTTTATGC
Translation
MTCYRGFLLGSCRRVAGGRAALRGSGSGADGRRHLGHGQPRELAGGGSPADGGFRPSRVVVVAKTTRYEFEQQRYRYAELSEEDLKQL - UNI30200 

- LALKGSSYSGLLERHHIHTKNVEHIIDSLR RDEGIEVRLVKRREYDEETVRWADAVIAAGG - UNI24358 - GDGTMLLAASKVLDRLKPVIGV

NTDPER - UNI17289 - RSEGHLCLPVRYTHSFPEALRRFSRGEFR RWLWRQRIRLYLEGTGINPTPVDLHEQQLSLNQHSRAFNIERAHDER - 

UNI18371 - RSEASGPQLLPVRALNEVFIGESLSSR RMPYCWAVAVDNLRRDIPNLKGL LASYYEISVDDGPWEKQKSSGLNLCTGTGSKAW WSF

NINRVAAQAVEDVLHIA ARRQGNLTLPLNKDLVEKV VTNEYNESLLYSPEEPKILFSIREPIANRVFSSSRQRCFSSK KVCVRSRCWDACMVVDGGT

SFEFNDGAIASMMINKEDELRTVILEQ

For any suggestions or comments, please send an email to unitrap@crg.es