Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000022262 (Dnahc5)
Chromosomal location
Chr 15: 28133521 - 28401800 (+)
Description
dynein, axonemal, heavy chain 5 Gene [Source:MGI Symbol;Acc:MGI:107718]
RefSeq_dna
NM_133365 
RefSeq_peptide
NP_579943.2 
UniGene
Mm.248464 
MGI
MGI:107718 
Uniprot/SWISSPROT
Q8VHE6 
Uniprot/SPTREMBL
Q5DTW4 Q8BZM5 
Human Ortholog
ENSG00000039139 (DNAH5)
Omim 608644 - CILIARY DYSKINESIA, PRIMARY, 3  612272 -  
UniTrap UNI31065
Vector Insertion
Chr 15: 28182349 - 28193306
Public Clones (sanger) IST14464C3 (tigm) IST13777A7 (tigm) IST11137C8 (tigm) IST12404E8 (tigm)
IST13707H3 (tigm) IST15004A10 (tigm) IST14677C12 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 17% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI36862
Vector Insertion
Chr 15: 28208403 - 28218808
Public Clones IST14633F11 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 24% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI36154
Vector Insertion
Chr 15: 28368004 - 28373836
Public Clones IST14197A12 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 87% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000067048
Sequence
AGGGAAGGATATATGAGCATCGCAGATGGACTGACTTCTCGCCTCAGTTCTGTGAATATCGAGAGTCACCCACATGCATGAGAAGCAACAGCGCGATGCT

GTGACCCTCTTAGAGTCTTTGCCTGTGATATTCCACTGGAGGATGAACAGCTCTCTTGGTAGTTAGAAGACCATTCTGGAGGAGCTGACTTGGGGCCATC

CCAGATTGCTGGGATGTTTAGGATCGGCAGACGACAACTCTGGAAGCAGAGTGTCACCCGAGTTCTGACG CAACGACTGAAAGAAGAGAAGGAAGCCAA

GAGGGCCCGTCTGGATGGGCGGCATGACTATCTGTTTGCAATTGTAGCTTCCTGTTTGGACCTGAACAAACCAGAAGTGGAAGATGCTCTTCTTGAGGGT

AATCAG ATTGAAAGAATGGATCAGCTTTTTGCTGTTGGTGGACTCCGTCATCTCATGTTTTACTATCAGGATGTGGAGGGAGCAGAAGCAG GGCACTG

TGGTTCCTCAGGAGGGGTGAATCCTGCCTCCGGAAAGATGAAAAAGCCCAAGGTGTTCGTGACCGAAGGGAAAGACGTTGCTCTTATGGGAGCATGTGTG

TTCTTCATCAGGTCTGACCCATCCAAAGCCATTACGCCTGAGAACATCCACCGG GAGGTGAGCTTTAACACGTTAGACACGGCAGATGGGGGCCTGTTG

AACAGCGTGAGGCGTCTGCTCTCAGACATCTTCATCCCAGCTCTCAGGGCCTCAAGCCATGGCTGGGGTGAGCTCGAGGGGCTACAGGATGCATCCAGCA

TTCGGCAGGAGTTCCTGAGCTCTCTGGAAGGCTTTGTGGGCATCTTGTCAGGTGCACAGAACAGTCTGAAGGAGAAG GTGAACCTTCAAAAATGTGACA

TCATTGAACTAAAATCTCTGAAGGAACCCACGGACTACTTGGCTCTAGCTAGTAATCCCGAGACTGTGGAAAAAGTAGAGTGCTGCATGAGAGTGTGGAT

CAAACAGATGGAGCAG ATCCTTGCTGAGAACAGTCAGCTACGGAAGGAAGCGGACGATGTGGGGCCCCGAGCAGAGCTGGAGCACTGGAAACAAAGGCT

CTCCAGATTTAATTACCTCTTAGATCAGCTGAAAAGCCCCGACGTGAAGGCTGCGCTGGCATTGCTTGCTGCGGCCAAGTCCAAGCTTCTGAAG GTTTG

GAGAGATACAGACATTAGGATCACTGACGCAGCCAATGAAGCAAAAGACAATGTCAAGTATTTGTACACACTGGAGAAATGTTGTGACCCTCTGTACAGC

AGTGACCCT GTAACTATGATAGATGCGATTCCTACACTTATAAATGCAATTAAGATGGTTTACAGCATCTCTCACTACTATAACACCTCTGAGAAGATC

ACATCTCTGTTTGTAAAG GTGACAAATCAGATGATATCTGCATGTAAAGCCCATATCACCAACAATGGGACTGCCACCATCTGGAGCCAGCCTCAGGAG

ATTGTTATGCAAAAAATAGCAGCTGTGATTAAGCTCAAGCAG GGATACCAATCCTGCTTTCAGGAGACAAAACAAAAGCTTAAGCAAAATCCAAGCGAA

AAACAATTTGACTTTAGTGAGATGTATATTTTTGGAAAATTTGAAACTTTCCACCGACGTCTGGCCAAGATAATGGACATCTTCACTACCTTCAAGACAT

ACTCAGTCCTGCAAGATTCCAAAATAGAGGGGTTGGAAGACATGGCGACTAAGTACCAG GACATTGTTGCTGCCATAAAGAAGAAAGAGTATAACTTCT

TAGATCAACGGGAAATGGATTTTGACCAAGATTATGAAGAGTTTTGCAAGCGGATTAATGAGCTTCAT AATGACCTGCAGAGGTTCATGGACATCACAT

TTGAAAAGATTCCAAGCACGAGGCAAGCTCTAAGCACGCTGAAGAAATTCGAAAG ACTGAATATACCTAATCTTGGTATTGAGGAAAAATACCAAATAA

TTTTCCAGAATTTTGCGACTGACATCGACACGATTTCTAAGCTGTATACGAAACAGAAGTACGATCCGCCCTTGGCTCGCAACCAGCCCCCCATAGCTGG

GAAGATCTTGTGGGCCCGGCAGCTATTCCACAGGCTGGAGCAGCCAATGCAACTCTTCCAGCAGCATCCCTTTGTGCTGAGGACTGCGGAGGCCAAACCT

GTGATCCGCAGCTATAACAGGATAGCCAAGGTCCTCTTGGAGTTTGAGGTCCTCTACCACAGGGCCTGGCTTCAGCAG ATTGAAGAAATTCATGCAGGT

CTTGAGGCTTCCTTATTGGTGAAGGCTCCAGGCACAGGGGAGTTGTTTGTGAACTTTGATCCTCAGATATTAGTCTTATTTAGAGAAACACAATGCATGT

CTCAGTTGGGTCTACCTGTGTCACCGTTTGCAGCTGCCCTCTTCCAGAAGCGGGACATGTTCAAAAAGAATTTCAGTGACATGAAG ATGATGCTGTCTG

AATACGAGAGAGTGAAGTTGAAAATGCCTCCTGCCATCGAGCAGTTGATGTTTCCACACCTGGCTAGAGTGGATGAAGCCCTCCAGCCGGGCCTGGCTGT

CCTGACTTGGACGTCCCTGAATATTGGGGGCTATTTAGAAAATGCCTTTGCAAAGATCA - UNI31065 - AGGACCTGGAGCTGCTGCTTGACCGGG

TCAATGACTTGATTGAGTTCCGCATCCACGCCATCCTGGAGGAAATGAGTAGCATGGCTCTTTGTCAGCTCCCTCAGGATGACCCCCTGACTTGTGAAGA

ATTCCTCCAAATGACAAAG GATCTCTGTGTGAGTGGTGCGCAGCTACTCCATTTTAAAAGCTCCCTTGTGGAGGAAGCAGTCAATGAGCTAATAAACAT

GTTATTGGATGTGGATGTACCACCTGAAGAAGCAGCCGAAAACGTCTGCCATGAGAACGCCAGTCCTAGCGGTAACACTTCAG GAAGAAGAGAAGGGCA

TTCTGAGGCCTTGGCATCTTCCTTCAATGCCGGGGCCAGCTCTCTGCCATTGACAGCAACTGCAAGAAAGAAGAAAGAAACCGAGGTGTTAGAGGAAGCC

CGTGAGCTGCTCTCCCACTTTAACCACCAGAACACAGATGCTCTTTTGAAAGTGACCAGGAATACACTTGAGGCCATTCGCAGACGCATTCACTTCTCCC

ACATGATTAACTTCCGGG ACAGTAATGATGCGTCTAAGGCAAAGCAGAACCATCTGCCCATTTTCCGGGCAAGTGTCACTCTGGCCATTCCCAACATCG

CTATGACTCCTGCCCTGGAAGACATACAGCAGACGCTGAACAAAGCCGTGGAATGCATCATCAGTGTCCCCAAGGGGGTTAGACAGTGGAGCAGCGAGCT

GTTGTCCAAG AGAAAGATGCATGAAAGAAAAATGGCTGCCGTGAAGAACAACGAAGACAGTGATTCAGACGCTGAGGTGGAGGAAAATGAGCTGCAAG 

AAACTCTGGAGATAGCATCCATAAACTTACCCATCCCAGTGCAAACCCAGAATTACTATAAGAATATTTCTGACAACAAAGAGATTGTAAAGTTGGTATC

TGTGCTCAGCACAGTCATCAGCTCCACCAAGAAG GAAGTTATCACATCCATGGACCGCTTCAAACGCTACAATCACATTTGGCAGAAGGAGAAAGAAGA

CACCATCATGACCTTTATTGCACAAAACCCTTTGCTTCCTGAGTTTGAGTCCAGGATTCTTTATTTTCAAAGCCTGGAGCAGGAAATTAATGCAGAGCCT

GAATACATCCGTGTGGGTTCCATTGCTCTATATACAG CTGATTTGAAGCTTTCACTGACCGCAGAGACGAAAGCCTGGATGGCGGTCATAGGCCGTCAC

TGCAACAGGAAGTACAGGGCTGAGATGGAAAACATTCTCACAGTTGTCGAAGAATCCCAGAAGAAACTGAGCCGGCCGATCAAGGACCTGGATGATATTA

GGATAGCAATGGCGGCCCTGAAGGAGATAAGGGAGCAGCAGATCTCCACCGACTTCCAAGTGGGACCTATTGAG GAATCCTATGCCCTCCTTAACAAGT

ATGGACTTCTGGTAGCCAAGGAAGAGATGGACAAAGTGGACACTTTGCGCTATGCTTGGGAGAAGCTGCTGGCCCGGGCCAGTGATGTTCAGAATGAGTT

AGGCGCTCTGCAGCCCAGTTTCCGGAAAGAGCTCATCAGCACAGTGGAGGTGTTCCTCCAAGACTGCCAGCAGTTTTACCTGGACTATGATTTG AATGG

TCCGATGGCAAGTGGATTGAAGCCCCAGGAAGCCAGCGGCAGGCTTATTATATTCCAG AATCAATTCGATAACATATATCGTAAATACATCACCTACAC

TGGAGGAGAGGAACTTTTTGGTTTGCCAGTTACACCGTATCCTCAGCTTCTTGAGATAAAGAGGCAGCTGAATCTTCTACAGAAAATATACAGCCTGTAC

AACAATGTCATCGAGACTGTGAATAGTTATCAAGATACCCTTTGGTCAGACGTGAACATTGAAAAAATCAACAATGAACTCTTAGAATTCCAAAACAG G

TGTCGGAAGCTGCCTCGGGCCCTGAAGGATTGGCAGGCCTTTCTGGATCTGAAGAAGACCATTGATGACTTCAGTGAGTGCTGTCCATTGCTGGAGTACA

TGGCCAGTAACGCCATGGTGGAACGACACTGGCAGAGGATCACTGCTCTCACTGGGCACAGTCTGGATGTGGGCAATGAGACCTTTAAGTTACGAAATAT

CATGGAAGCTCCTCTGCTAAAATACAAAGAGGAAATTGAG GACATTTGCATCAGTGCCGTGAAGGAGAGAGACATTGAGCAAAAGCTGAGGCAAGTGAT

CAATGAGTGGGACAACAAAACATTAACATTTAGTGGCTTTAAGACCCGTGGAGAACTCCTCCTGAGAGGAGACAGTACCTCCGAAGTCATCGCCAGCATG

GAGGATAGCTTGATGCTGCTGGGCTCTCTCCTTAGCAACAG GTACAATATGCCATTCAAAGCCCAGATTCAAAAATGGGTGCAGTGCCTTTCCAACTCA

ACAGACATCATTGAGAACTGGATGACCGTTCAAAACTTGTGGATTTATCTAGAAGCTGTCTTCGTGGGAGGAGACATTGCCAAGCAGCTGCCCAAG GAA

GCCAAGCGCTTTTCCAATATAGATAAGTCTTGGGTGAAGATCATGACACGGGCACATGAGATACCAAATGTGGTTCAGTGTTGTGTTGGAGATGAGACCA

TGGGGCAGCTACTGCCACACTTACTGGACCAGTTGGAAATCTGCCAGAAGTCGCTCACAGG ATACTTGGAGAAGAAAAGGCTGTGTTTTCCTCGCTTCT

TTTTCGTCTCAGATCCCGCTCTGCTGGAGATTCTGGGCCAGGCATCGGACTCCCACACCATCCAGGCCCATTTGCTGAACGTGTTTGACAACATTAAAAC

TGTCAAGTTCCATGACAAG ATCTATGATCGGATTCTGTCAATCTCCTCTCGGGAGGGCGAGACAATTGAATTGGACAAGCCTGTGATGGCAGAGGGCAA

TGTGGAAGTCTGGCTTAATTCTCTGCTGGAGGAGTCACAGTCCTCATTACATCTTGTGATTCGCCAGGCAGCTGCAAATATTCAAGAACCCGGTTTCCAA

TTGATTGAATTTCTTTCTTCCTTCCCCGCTCAG GTTGGATTATTAGGAATTCAGATGCTATGGACCCGGGACTCAGAAGAAGCCCTTCGAAATGCCAAG

TTTGATAAGAAAATCATGCAGAAGACCAATCAGGCCTTCCTAGAGCTACTGAACATGCTGATCGAGATTACCACGAAGGACCTGAGCTCCATGGAACGGG

TTAAATACGAGACTCTGATTACTATCCATGTGCACCAAAGGGACATCTTTGATGACCTG TGTCACATGCACGTCAAGAGCCCTACGGACTTTGAATGGC

TGAAACAGTGCAGGTTCTATTTTAAGGAGGATTCTGACAAGACGATGATCCACATCACCGACGTGGCTTTCATATACCAGAATGAGTTTTTAGGCTGCAC

TGACAGACTTGTCATAACACCGCTCACGGACAG GTGCTATATCACATTGGCTCAAGCTCTGGGCATGAGCATGGGAGGAGCCCCTGCTGGTCCCGCAGG

GACAGGCAAGACAGAGACCACCAAGGACATGGGCCGATGTCTTGGGAAATATGTTGTAGTTTTCAACTGCTCGGACCAGATGGATTTCCGAGGACTTGGG

CGGATATTCAAAG GACTGGCACAGTCTGGGTCCTGGGGTTGCTTTGATGAATTCAACCGTATCGATCTACCAGTTCTGTCAGTTGCAGCCCAGCAAATC

TCCATTATTCTCACGTGTAAAAAGGAGCATAAAAAATCTTTCATTTTTACTGATGGAGATAATGTGACCATGAACCCAGAATTTGGACTTTTTCTAACCA

TG AACCCTGGCTATGCTGGACGCCAGGAGCTCCCGGAGAACTTGAAGATCAACTTCCGCTCTGTGGCTATGATGGTCCCTGACCGGCAGATTATCATCA

GGGTGAAGCTGGCCAGCTGCGGCTTCATTGATAACGTAGTTCTGGCCAGAAAATTTTTCACGCTCTACCAGCTGTGTGAGGAGCAGCTCTCGAAGCAG G

TTCACTATGACTTTGGTCTCCGCAACATTCTGTCAGTTCTGCGCACCCTGGGAGCAGCAAAAAGAGCCAGTCCCACGGATACAGAATCCACCATCGTCAT

GCGCGTGCTGCGGGACATGAATCTTTCCAAACTG ATTGATGAAGATGAGCCCCTGTTTTTGAGTTTGATTGAAGATCTATTTCCAAATATTCTTTTGGA

CAAGGCAGGCTATCCTGAGCTGGAGACAGCAATCAGTAAACAG GTTGAGGAAGCTGGCTTAATTAACCACCCTCCTTGGAAACTGAAAGTCATCCAGTT

GTTTGAAACGCAGAGGGTGAGGCACGGCATGATGACCCTGGGGCCTAGTGGGTCAGGGAAGACCACCTGCATCCACACCCTGATGAAAGCCATGACAG A

TTGTGGAAAGCCTCACAGAGAAATGAGGATGAATCCCAAAGCAATCACAGCCCCACAGATGTTTGGTCGACTCGATGTGGCCACAAACGACTGGACTGAT

GGAATATTTTCTACCCTTTGGAGGAAGACACTGAAAGCAAAGAAAG GGGAACATATCTGGATTGTTCTTGATGGTCCAGTTGATGCCATCTGGATTGAA

AATCTGAATTCTGTGCTGGATGATAATAAAACCCTGACTCTGGCCAATGGCGACCGGATCCCCATGGCTCCAAACTGCAAGATTGTTTTTGAACCTCATA

ACATTGACAATGCTTCTCCCGCCACCGTCTCAAGAAATGGGATGGTTTTCATGAGTTCCTCAGTCCTCGACTGGAGTCCTATTCTTGAG GGTTTTCTCA

AGAGACGGTCTCCTCAAGAGGCTGAAATCCTTCGACAGCTGTATGCAGAGACTTTCCCGGACCTGTATCGGTTCAGCATCCAGAACCTGGAGTTCAAGAT

GGAGGTACTGGAAGCCTTTGTGATCACACAGAGCACCCACATGCTGCAAGGCCTGATCCCCCCAAAG GAGCAGGCCGGGGAGGTGGACCCGGAGCATCT

GGGGAGGCTGTTTGTCTTTGCCATGATGTGGAGTGTGGGCGCAGTCCTGGAGTTGGAAGGTCGCCGGAGGATGGAACTCTGGCTGCGCTCTCGAGAAGGG

CCCACACTGCACCTGCCACAGCTGACGGACGCTGGGGACACCATGTTCGACTACTATGTCGCGCCAAACG GTACTTGGAGGCATTGGAGCCTGTGTACC

CCAGAATATGTGTACCCACCTGACACCACCCCAGAATATGGATCTATCCTTGTGCCAAATGTGGACAATGTGCGGACCGACTTCCTAATTAAAACCATTG

CCAAACAAGGCAAG GCTGTGCTGTTAATTGGTGAGCAAGGGACAGCCAAAACAGTCATCATCAAAGGATTTATGTCAAAATTTGACCCTGAAAGTCACA

TGGTGAAGAATCTGAACTTTTCTTCGGCGACCACCCCAGTGATGTTTCAG AGGACAATAGAGAGCTACGTGGATAAACGCATGGGCACGACATATGGTC

CTCCTGCGGGGAAGAAAATGGCTGTCTTTATTGATGATTTAAATATGCCTGTAATCAACGAATGGGGTGATCAG GTTACTAATGAGATTGTCCGACAGC

TGATGGAACAAAGTGGGTTCTATAACCTGGAGAAGCCTGGAGAGTTCACTAGCATTGTGGACATCCAGTTCTTGGCAGCCATGATCCATCCTGGGGGTGG

ACGCAATGACATACCACAGCGCTTGAAGAGACAGTTCTCCATATTCAACTGTACCTTGCCTTCAGATGCTTCCATGGACAAGATCTTTG GTGTGATTGG

GGCAGGCTACTACTGTGCCCAGCGGGGCTTCTCGGAGGAAGTTCAAGATGCTCTGATAAAGCTGGTACCCCTGACGCGCCGTCTGTGGCAGATGACCAAA

CTGAAGATGCTCCCAACGCCTGCGAAATTCCACTATGTGTTCAACCTTCGAGACCTCTCCAGGATCTGGCAGGGCATGCTGAACATCACTTCAGAGGTCA

TCAAAGACACAGAC GAACTCCTCAGGCTGTGGAAGCATGAGTGTAAACGTGTGATAGCTGACCGCTTTAGCATGTCCAGCGATGTGACCTGGTTCGATA

AGGCTGTTGTCAGTTTGGTAGAGGAGGAGTTTGGTGAAGAGAAAGCACCTGTAGTGGATTGTGGAGTTGATGCTTATTTTGTGGATTTCTTGAGGGATGC

ACCAGAAGCTACAG GTGAAACACCTGAGGAGGCTGATGCTGAAATGCCAAAGCTTTATGAGCCAATCGCATCCCTTAACCACCTGCGAGAGCGTCTGAG

TGTGTTCCTGCAGCTCTATAACGAGAGCATCCGTGGCACTGGCATGGACATGGTGTTCTTCATAGATGCAATGGTTCACTTAGTCAAG ATCTCTCGAGT

CATACGCACTCCTCGGGGAAATGCCCTTCTGGTTGGTGTGGGTGGATCAGGAAAGCAGAGCTTGACAAGGTTGGCTTCATTCATCGCTGGCTATACCTCT

TTCCAGATCACTCTGACAAG ATCCTACAACACCTCGAACCTGATGGAAGATCTGAAGGTCTTGTACAGGACTGCTGGCCAGCAAGGCAAAGGGATCACT

TTTATTTTCACAGACAATGAGATTAAAGAGGAGTCGTTTCTGGAGTACATGAACAATGTCCTGTCATCGGGCGAG GTCTCCAACCTCTTTGCTCGGGAT

GAAATTGATGAAATCAACAGTGACCTGACACCCATTATGAAGAAGGAGCATCCCAGGCGCCCGCCCACCAATGACAACCTGTACGAGTATTTCATGAGCA

GGGTCCGAGGAAACCTGCACATTGTGCTCTGCTTTTCTCCCGTGGGGGAGAAATTTCGAAACCGAGCTTTGAAGTTCCCCGCCCTTATTTCAGGATGCAC

CATCGACTGGTTCAGCCGATGGCCCAAGGATGCTTTAGTTGCTG TGTCGGAACACTTCCTCTCATCCTATACCATTGACTGCACAGCGGAGATCAAGAA

GGAATTGGTCCAGTGCATGGGCTCTTTTCAGGATGGGGTAGCTGAGAAATGCGCCGATTACTTCCAGAGGTTCCGGCGCTCTACCCACGTGACGCCCAAA

TCCTACCTCTCCTTTATTCAGGGCTATAAATTCATATATGAAGAAAAGCACATGGAAGTGCAGAGCCTGGCCAACAG AATGAATACTGGATTGGAAAAG

CTAAAAGAAGCGTCAGAATCGGTGGCAGCCTTGAGCAAAGAACTGGCAGGAAAAGAGAAGGAGCTGCAGGTGGCCAATGAGAAAGCAGACACG GTTTTA

AAGGAAGTCACAATGAAGGCACAGGCTGCAGAGAAGGTCAAAGCTGAGGTGCAGAAGGTAAAGGACAAAGCACAGGCCATTGTCGACAGCATCTCCAAGG

ACAAAGCCATCGCAGAAGAGAAATTAGAGGCAGCAAAGCCAGCCCTAGAAGAGGCGGAAGCCGCACTCCAG ACCATCAAGCCCTCTGACATTGCCACAG

TGCGCACCCTGGGCAGACCCCCTCACCTGATCATGCGGATCATGGACTGTGTGCTGCTGCTGTTTCAGAGGAGGGTCAATGCGGTGAAAATTGACGTGGA

CAAAGGCTGCACCATGCCTTCCTGGCAGGAGTCTTTGAAATTGATGACAGCAGGAAACTTTCTCCAGAACCTACAG CAGTTCCCCAAAGACACGATCAA

TGAAGAAGTGATAGAATTTTTGAATCCTTACTTTGAAATGTCCGACTACAACATCGAGACGGCCAAGCGCGTCTGTGGGAATGTAGCCGGACTTTGTTCC

TGGACCAAAGCTATGGCTTCCTTTTTTTCTATAAACAAGGAGGTGCTCCCTCTGAAG GCCAACTTGATAGTGCAAGAGAATCGTCACATCCTGGCCATG

CAGGACCTGCAGAAAGCCCAGGCTGAGCTGGATGCCAAGCAAGCAGAGCTTGATGTGGTGCAGGCAGAGTATGAACAGGCCATGGCAGAGAAGCAG ACC

TTGCTTGAAGATGCGGACCGGTGTAGGCATAAGATGCAGACAGCATCCACGCTCATCAGTGGCTTGGCAGGTGAAAAGGAGCGATGGACGGAACAAAGTA

AAGAGTTTGCTGCACAAACTAAACGGCTCGTAG GGGATGTGCTGCTGGCTACGGCTTTTCTGTCATACTCTGGTCCATTTAACCAAGAGTTTCGAGACC

TGCTGCTACATGATTGGAAGAAGGAAATGAAAGCTCGTAAAATCCCGTTTGGGAATGGTCTAAATCTCAACGAGATGCTGATCGATGCCCCTACTATCAG

CGAATGGAACCTCCAAGGCCTTCCAAATGATGACCTGTCCATCCAGAATGGAATTATTGTCACAAAAGCATCACGCTATCCTTTGCTCATTGACCCTCAG

ACTCAAGGCAAGATCTGGATTAAGAATAAAGAGAGCCAAAATGAACTCCAG ATCACATCTCTAAACCACAAGTACTTTAGAAACCACCTGGAGGACAGC

CTTTCACTGGGGAGGCCTTTGCTCATCGAGGATGTTGGAGAGGAATTAGACCCTGCTCTAGACAACGTTTTGGAAAAAAACTTCATTAAAACAGGATCTA

CTTTTAAG GTGAAGGTTGGAGACAAGGAAGTGGATGTCATGGACGGCTTTAAACTTTATATCACTACCAAACTGCCGAATCCAGCCTATACCCCAGAAA

TAAGTGCTCGGACCTCCATCATCGACTTCACTGTCACCGTGAAGGGCCTGGAGGACCAGCTACTGGGGAGAGTCATTCTCACGGAGAAGCAG GAACTGG

AGAAAGAACGAACTCATCTCTTGGAGGATGTAACTGCAAACAAAAGAAGGATGAAGGAGCTAGAAGATAATTTGCTTTACCGCCTGACAAGCACTCAAGG

GTCTCTGGTGGAAGATGAGAGTCTCATCATTGTGCTGAGCAACACCAAAAAGACAGCTGAGGAGGTGACACAGAAGCTAGAAATTTCTGGAGAGACAGAA

ATTCAAATTAACTCAGCCCGGGAGGAATACCGACCTG TTGCTACACGGGGCAGCATCCTCTACTTCCTGATCACGGAGATGCGCTTGGTTAATGAGATG

TATCAGACTTCGCTCCGTCAGTTTCTGGGCTTGTTTGACCTTTCCTTAGCCAG GTCTGTCAAGAGCCCAATTACAAGCAAGAGGATTGCTAATATCATT

GAGCACATGACCTATGAGGTATTCAAGTATGCTGCCCGAGGCCTATATGAAGAGCATAAATTCCTGTTCACTTTGTTGCTCACCCTAAAGATTGACATCC

AGAGGAACCTAGTCAAACATGAGGAGTTTCTCACTCTCATTAAAG GTGGTGCCTCATTGGATCTAAAAGCCTGTCCTCCTAAGCCATCAAAATGGATCC

TAGACATGACTTGGCTGAATTTGGTGGAACTTAGCAAACTTAAACAGTTTTCAGACATCCTTGATCAG ATATCAAGGAATGAAAAGATGTGGAGAGTTT

GGTTTGATAAAGAAAACCCAGAAGAGGAGCCGCTTCCAAATGCCTACGATAAATCTCTCGACTGCTTCAGACGCCTCCTTCTGATTAGGTCCTGGTGTCC

CGACAGAACCATTGCCCAG - UNI36154 - GCTCGCAAGTACATCATGGACTCCATGGGAGAAAACTATGCAGAGGGAGTTATCCTGGACTTGGAAA

AGACATGGGAGGAATCTGACCCACGGACACCACTCATCTGCCTCCTGTCCATGGGCTCCGACCCCACAGATTCCATCATTGCTTTGGGAAAGAGACTAAA

AATAGAAACACGCTATGTGTCCATGGGCCAGGGCCAGGAGGTCCATGCGAGGAAGCTGTTGCACCAGACCATGGCAAAT GGAGGATGGGTACTTCTACA

GAACTGCCACCTGGGACTTGACTTCCTGGATGAGCTAATGGACGTAGTTACAGAAACGGAGACTGTGCATGACACTTTCCGCCTGTGGATCACCACCGAG

GTTCACAAGCAGTTCCCCATCACTCTCCTTCAGATGTCCATCAAGTTTGCCAATGAGCCACCTCAGGGCCTCCGGGCGGGACTGAGAAGGACATATGGTG

 GTGTGAGCCAGGACCTACTGGATGTGAGTGTGGGGGCCCAGTGGAAGCCCATGCTATATGCGGTGGCCTTCCTACACTCCACTGTCCAGGAGCGGCGCA

AGTTCGGTCCTCTGGGGTGGAATATCCCTTACGAATTTAACCAAGCAGACTTCAATGCCACGGTGCAGTTCATTCAAAATCACCTAGATGATATGGATGT

CAAGAAG GGTGTATCCTGGACCACTGTCCGCTACATGATAGGAGAGATTCAGTATGGAGGCAGAGTCACTGATGACTACGATAAGAGGTTGCTGAACAC

ATTTGCAAAGGTTTGGTTCAGTGAAAACATGTTTGGACCAGATTTCACCTTTTACCAAGGATACAACATTCCAAAATGCAGTACAGTGGATGGCTATCTT

CAGTACATCCAG AGCTTGCCTGCCTATGACAGCCCAGAGGTGTTTGGGCTCCACCCCAATGCTGACATTACTTACCAGAGCAAGCTGGCCAAGGATGTG

CTGGACACTATCCTGGGCATCCAGCCCAAGGACAGCTCCGGTGGAGGGGACGAGACACGGGAGGCTGTGGTGGCCCGCCTGGCTGATGATATGCTAGAGA

AGCTTCCAGAAGATTATAGTCCTTTTGAA GTGAAGGAGAGATTGCAGAAGATGGGACCATTCCAGCCCATGAACATTTTCCTCAGGCAGGAGATTGACA

GGATGCAGAGGGTACTCAGCCTTGTCCGTAGCACCCTGACTGAGCTGAAACTAGCTGTTGATGGCACCATTATCATGAGTGAAAATCTAAGAGATGCTCT

GGATTGCATGTTTGATGCCAGAATCCCTGCTCGGTGGAAAAAG GCATCATGGGTGTCTAGTACCCTGGGCTTCTGGTTTACTGAACTTCTAGAAAGAAA

CTGCCAGTTCACCTCCTGGGTTTCCAATGGCAGACCCCACTGCTTTTGGATGACAGGTTTCTTTAACCCGCAGGGATTCTTAACTGCGATGCGACAG GA

AATAACTCGAGCCAACAAAGGATGGGCTTTGGACAATATGGTTCTTTGCAATGAAGTCACCAAATTTATGAAGGACGACATTTCTGCTCCTCCTACAGAA

GGGGTCTACGTCTATGGCTTATATCTTGAGGGTGCTGGCTGGGACAAAAGGAACATGAAACTCATTGAATCCAAACCCAAAGTGCTTTTTGAGCTGATGC

CTGTCATAAGGATTTTTGCAGAAAACAATA CTGCAAGAGATCCTCGGTTGTACTGCTGCCCCATCTACAAGAAGCCAGTTCGAACAGACTTGAACTACA

TTGCTGCTGTGGACCTCAAGACAGCTCAGGCCCCTGAACACTGGGTTCTCCGTGGGGTTGCCCTTCTCTGTGATGTCAAGTAACAGAAACATATGATCCA

AAGTATTTTAGTCTTCGTTTCTCTGTCAGTGCTGGGCATATATAAGTCAGACTGTGTTGTGTGCAATGAATGAGATGACATCATCCCATACACTTCCTTG

GACTCTTAGCTACATTTCACATGTTTTGTTATTGGTGGCTGACTCCTGCATTTCTTTAAAAAAATACTTGTGATTTAAAAGCATAGTTAACATCTCCTAA

TGAATTGTGGGCATCAAATCTCTAATTGTCTATTTTCTTTTTCCTTCTATCTGAAGTTTATGTTAAATGGATGCTATTACCTCCTAGAGATTGTTTGCCT

GTTAATATGGTTCTACTGGTAGCAGCTAGGTTCTCTAAAGTAACATGGGAAGCTTGTGTGAAGGTTGTTTCTGTTACCTTTTGCTTTTTGGCCAGGTCAG

GAGACTTATATTCAAGGTTTCAAGCAGCTAATTAATTTTACAAAACAACAGGAAATAAAAAATGGATTAAGATTATAAATAGGCAACTCAGGGTAACTTA

GAGTGTAAACATGTAGAGCAACATTCAGTGATGCTTATAATTAATATGGGGATCCTGATTGATGTCTTACAAAAAGTGTGGGGTCTGTACCGACATGCAC

CCACACATCGTTAGAGCAATGTGAATTGATCCAAGCTTACTGTAAAAGAATTTAAACAGAGAAAGAAACATTAAAAACAAACAAACACACTCACAAGCTT

AGATCCTTATTGTTCTATATCAAGGAGGTAAACACACTGAAGACAAATTTTACATATAAAGTTGTACTTAATAAAGGAAAGGAATGGACCTGCTTCAAAT

GTTCAACTTTAAAGCTATGCTAACAGAAACCAGGAGGTATTAGACAACTATGAAATGTGGTATCGGAAAGTGCTTTTGAAGAAAAGACAAGCACGCTAAT

AATTGAAACATGCCATTTACAAAGTATTGATCTCTTTGTGATTACAGCTAAATACAATGAATTTGAATGTGGACAAAAATTAAATAGTAATATGAGAAAC

TAAAGACAGCAATTTAAAATGCAGTAGCCAGAAGGATAGGGATGATCAAAACTGCCCTACAAGGTGTGTGAGGGATTCCAAAGGGATTTTTATTAACTAG

GAAATTCTTCATTTATTTTGTTTTAAGTTTTGGTTATTAATGACCTTCTGCTTCACCTAGTGCGTATTGACTAGGAAGCGTAATCGGTGTTATGATTAGA

ATTGGGGTTCAGGTGTAGGTCTGATTACTAGCTGTAGTTTCTTTTGAGGTAATGGGTTTTTTATGTGTGCAGTAGGTGGAGAGGGTGTTTGTTCTCCACC

ACATACAGGTCTGTGATCAGTATCATTACATTGTGCTCATTATACCTGTTTAGTTAATGTGACTACTACTGATCATTGGTGATACTGCTCCCATTTAAAT

CGCTTCTCTTGTATGGATAAATATTTTGGTTGATCCTTGAGAATTATTGCTGATTATTTTGTTCTTAAAAACAGATAATAAAAATTAGAATGTGATGCAA

ATTAATAAAATATTGTTAGT
Translation
MFRIGRRQLWKQSVTRVLT QRLKEEKEAKRARLDGRHDYLFAIVASCLDLNKPEVEDALLEGNQ IERMDQLFAVGGLRHLMFYYQDVEGAEAG GHCG

SSGGVNPASGKMKKPKVFVTEGKDVALMGACVFFIRSDPSKAITPENIHR EVSFNTLDTADGGLLNSVRRLLSDIFIPALRASSHGWGELEGLQDASSI

RQEFLSSLEGFVGILSGAQNSLKEK VNLQKCDIIELKSLKEPTDYLALASNPETVEKVECCMRVWIKQMEQ ILAENSQLRKEADDVGPRAELEHWKQR

LSRFNYLLDQLKSPDVKAALALLAAAKSKLLK VWRDTDIRITDAANEAKDNVKYLYTLEKCCDPLYSSDP VTMIDAIPTLINAIKMVYSISHYYNTSE

KITSLFVK VTNQMISACKAHITNNGTATIWSQPQEIVMQKIAAVIKLKQ GYQSCFQETKQKLKQNPSEKQFDFSEMYIFGKFETFHRRLAKIMDIFTT

FKTYSVLQDSKIEGLEDMATKYQ DIVAAIKKKEYNFLDQREMDFDQDYEEFCKRINELH NDLQRFMDITFEKIPSTRQALSTLKKFER RLNIPNLGI

EEKYQIIFQNFATDIDTISKLYTKQKYDPPLARNQPPIAGKILWARQLFHRLEQPMQLFQQHPFVLRTAEAKPVIRSYNRIAKVLLEFEVLYHRAWLQQ 

IEEIHAGLEASLLVKAPGTGELFVNFDPQILVLFRETQCMSQLGLPVSPFAAALFQKRDMFKKNFSDMK MMLSEYERVKLKMPPAIEQLMFPHLARVDE

ALQPGLAVLTWTSLNIGGYLENAFAKIK - UNI31065 - KDLELLLDRVNDLIEFRIHAILEEMSSMALCQLPQDDPLTCEEFLQMTK DLCVSGAQ

LLHFKSSLVEEAVNELINMLLDVDVPPEEAAENVCHENASPSGNTSG GRREGHSEALASSFNAGASSLPLTATARKKKETEVLEEARELLSHFNHQNTD

ALLKVTRNTLEAIRRRIHFSHMINFRD DSNDASKAKQNHLPIFRASVTLAIPNIAMTPALEDIQQTLNKAVECIISVPKGVRQWSSELLSK RKMHERK

MAAVKNNEDSDSDAEVEENELQE ETLEIASINLPIPVQTQNYYKNISDNKEIVKLVSVLSTVISSTKK EVITSMDRFKRYNHIWQKEKEDTIMTFIAQ

NPLLPEFESRILYFQSLEQEINAEPEYIRVGSIALYTA ADLKLSLTAETKAWMAVIGRHCNRKYRAEMENILTVVEESQKKLSRPIKDLDDIRIAMAAL

KEIREQQISTDFQVGPIE ESYALLNKYGLLVAKEEMDKVDTLRYAWEKLLARASDVQNELGALQPSFRKELISTVEVFLQDCQQFYLDYDL NGPMASG

LKPQEASGRLIIFQ NQFDNIYRKYITYTGGEELFGLPVTPYPQLLEIKRQLNLLQKIYSLYNNVIETVNSYQDTLWSDVNIEKINNELLEFQNR RCRK

LPRALKDWQAFLDLKKTIDDFSECCPLLEYMASNAMVERHWQRITALTGHSLDVGNETFKLRNIMEAPLLKYKEEIE DICISAVKERDIEQKLRQVINE

WDNKTLTFSGFKTRGELLLRGDSTSEVIASMEDSLMLLGSLLSNR RYNMPFKAQIQKWVQCLSNSTDIIENWMTVQNLWIYLEAVFVGGDIAKQLPK E

AKRFSNIDKSWVKIMTRAHEIPNVVQCCVGDETMGQLLPHLLDQLEICQKSLTG GYLEKKRLCFPRFFFVSDPALLEILGQASDSHTIQAHLLNVFDNI

KTVKFHDK IYDRILSISSREGETIELDKPVMAEGNVEVWLNSLLEESQSSLHLVIRQAAANIQEPGFQLIEFLSSFPAQ VGLLGIQMLWTRDSEEALR

NAKFDKKIMQKTNQAFLELLNMLIEITTKDLSSMERVKYETLITIHVHQRDIFDDL CHMHVKSPTDFEWLKQCRFYFKEDSDKTMIHITDVAFIYQNEF

LGCTDRLVITPLTDR RCYITLAQALGMSMGGAPAGPAGTGKTETTKDMGRCLGKYVVVFNCSDQMDFRGLGRIFKG GLAQSGSWGCFDEFNRIDLPVL

SVAAQQISIILTCKKEHKKSFIFTDGDNVTMNPEFGLFLTM NPGYAGRQELPENLKINFRSVAMMVPDRQIIIRVKLASCGFIDNVVLARKFFTLYQLC

EEQLSKQ VHYDFGLRNILSVLRTLGAAKRASPTDTESTIVMRVLRDMNLSKL IDEDEPLFLSLIEDLFPNILLDKAGYPELETAISKQ VEEAGLINH

PPWKLKVIQLFETQRVRHGMMTLGPSGSGKTTCIHTLMKAMTD DCGKPHREMRMNPKAITAPQMFGRLDVATNDWTDGIFSTLWRKTLKAKKG GEHIW

IVLDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMAPNCKIVFEPHNIDNASPATVSRNGMVFMSSSVLDWSPILE GFLKRRSPQEAEILRQLYAETFP

DLYRFSIQNLEFKMEVLEAFVITQSTHMLQGLIPPK EQAGEVDPEHLGRLFVFAMMWSVGAVLELEGRRRMELWLRSREGPTLHLPQLTDAGDTMFDYY

VAPNG GTWRHWSLCTPEYVYPPDTTPEYGSILVPNVDNVRTDFLIKTIAKQGK AVLLIGEQGTAKTVIIKGFMSKFDPESHMVKNLNFSSATTPVMFQ

 RTIESYVDKRMGTTYGPPAGKKMAVFIDDLNMPVINEWGDQ VTNEIVRQLMEQSGFYNLEKPGEFTSIVDIQFLAAMIHPGGGRNDIPQRLKRQFSIF

NCTLPSDASMDKIFG GVIGAGYYCAQRGFSEEVQDALIKLVPLTRRLWQMTKLKMLPTPAKFHYVFNLRDLSRIWQGMLNITSEVIKDTD ELLRLWKH

ECKRVIADRFSMSSDVTWFDKAVVSLVEEEFGEEKAPVVDCGVDAYFVDFLRDAPEATG GETPEEADAEMPKLYEPIASLNHLRERLSVFLQLYNESIR

GTGMDMVFFIDAMVHLVK ISRVIRTPRGNALLVGVGGSGKQSLTRLASFIAGYTSFQITLTR RSYNTSNLMEDLKVLYRTAGQQGKGITFIFTDNEIK

EESFLEYMNNVLSSGE VSNLFARDEIDEINSDLTPIMKKEHPRRPPTNDNLYEYFMSRVRGNLHIVLCFSPVGEKFRNRALKFPALISGCTIDWFSRWP

KDALVAV VSEHFLSSYTIDCTAEIKKELVQCMGSFQDGVAEKCADYFQRFRRSTHVTPKSYLSFIQGYKFIYEEKHMEVQSLANR RMNTGLEKLKEAS

ESVAALSKELAGKEKELQVANEKADT VLKEVTMKAQAAEKVKAEVQKVKDKAQAIVDSISKDKAIAEEKLEAAKPALEEAEAALQ TIKPSDIATVRTL

GRPPHLIMRIMDCVLLLFQRRVNAVKIDVDKGCTMPSWQESLKLMTAGNFLQNLQ QFPKDTINEEVIEFLNPYFEMSDYNIETAKRVCGNVAGLCSWTK

AMASFFSINKEVLPLK ANLIVQENRHILAMQDLQKAQAELDAKQAELDVVQAEYEQAMAEKQ TLLEDADRCRHKMQTASTLISGLAGEKERWTEQSKE

FAAQTKRLVG GDVLLATAFLSYSGPFNQEFRDLLLHDWKKEMKARKIPFGNGLNLNEMLIDAPTISEWNLQGLPNDDLSIQNGIIVTKASRYPLLIDPQ

TQGKIWIKNKESQNELQ ITSLNHKYFRNHLEDSLSLGRPLLIEDVGEELDPALDNVLEKNFIKTGSTFK VKVGDKEVDVMDGFKLYITTKLPNPAYTP

EISARTSIIDFTVTVKGLEDQLLGRVILTEKQ ELEKERTHLLEDVTANKRRMKELEDNLLYRLTSTQGSLVEDESLIIVLSNTKKTAEEVTQKLEISGE

TEIQINSAREEYRPV VATRGSILYFLITEMRLVNEMYQTSLRQFLGLFDLSLAR RSVKSPITSKRIANIIEHMTYEVFKYAARGLYEEHKFLFTLLLT

LKIDIQRNLVKHEEFLTLIKG GGASLDLKACPPKPSKWILDMTWLNLVELSKLKQFSDILDQ ISRNEKMWRVWFDKENPEEEPLPNAYDKSLDCFRRL

LLIRSWCPDRTIAQ - UNI36154 - ARKYIMDSMGENYAEGVILDLEKTWEESDPRTPLICLLSMGSDPTDSIIALGKRLKIETRYVSMGQGQEVHA

RKLLHQTMAN GGWVLLQNCHLGLDFLDELMDVVTETETVHDTFRLWITTEVHKQFPITLLQMSIKFANEPPQGLRAGLRRTYGG GVSQDLLDVSVGAQ

WKPMLYAVAFLHSTVQERRKFGPLGWNIPYEFNQADFNATVQFIQNHLDDMDVKK GVSWTTVRYMIGEIQYGGRVTDDYDKRLLNTFAKVWFSENMFGP

DFTFYQGYNIPKCSTVDGYLQYIQ SLPAYDSPEVFGLHPNADITYQSKLAKDVLDTILGIQPKDSSGGGDETREAVVARLADDMLEKLPEDYSPFE VK

ERLQKMGPFQPMNIFLRQEIDRMQRVLSLVRSTLTELKLAVDGTIIMSENLRDALDCMFDARIPARWKK ASWVSSTLGFWFTELLERNCQFTSWVSNGR

PHCFWMTGFFNPQGFLTAMRQ EITRANKGWALDNMVLCNEVTKFMKDDISAPPTEGVYVYGLYLEGAGWDKRNMKLIESKPKVLFELMPVIRIFAENNT

 TARDPRLYCCPIYKKPVRTDLNYIAAVDLKTAQAPEHWVLRGVALLCDVK

For any suggestions or comments, please send an email to unitrap@crg.es