Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000022312 (Eif3h)
Chromosomal location
Chr 15: 51618110 - 51697029 (-)
Description
eukaryotic translation initiation factor 3, subunit H Gene [Source:MGI Symbol;Acc:MGI:1915385]
RefSeq_dna
NM_080635 
RefSeq_peptide
NP_542366.1 
UniGene
Mm.289800 Mm.475110 
MGI
MGI:1915385 
Uniprot/SWISSPROT
Q91WK2 
Uniprot/SPTREMBL
Q8BMZ8 Q3THW7 Q3TII2 Q3TIK5 Q5M9L0 Q8BTX5 
Human Ortholog
ENSG00000147677 (EIF3H)
Omim not available
UniTrap UNI2356
Vector Insertion
Chr 15: 51674171 - 51696883
Public Clones (sanger) AD0565 (sanger) AF0014 (sanger) H006G08 (ggtc) P141H09 (ggtc)
P130C04 (ggtc)
Private Clones OST423492 (lexicon) OST276806 (lexicon) OST101700 (lexicon) OST66609 (lexicon)
OST35823 (lexicon)
Severity of mutation (?) Insertion after 12% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI643
Vector Insertion
Chr 15: 51630906 - 51674013
Public Clones DD0474 (sanger) CSG247 (baygenomics) YHD372 (baygenomics) A048F01 (ggtc)
A011E06 (ggtc) IST14734D1 (tigm) IST10877D3 (tigm)
Private Clones OST381099 (lexicon) OST365854 (lexicon) OST360373 (lexicon) OST65875 (lexicon)
Severity of mutation (?) Insertion after 27% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI1410
Vector Insertion
Chr 15: 51619585 - 51621538
Public Clones CH0662 (sanger)
Private Clones OST321769 (lexicon)
Severity of mutation (?) Insertion after 78% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI28472
Vector Insertion
Chr 15: 51618109 - 51618367
Public Clones not available
Private Clones OST30205 (lexicon)
Severity of mutation (?) Insertion after 91% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000090034
Sequence
TGGAAACATGGCGTCGCGCAAGGAAGGCACCGGCTCTACCGCCACCTCCTCCGGTTCTGCTGGCGGCGCGGTGGGGAAGGGCAAAGGCAAAGGCGGCTCC

GGAGATTCGGCCGTGAAGCAGGTGCAG - UNI643 - - UNI1410 - - UNI2356 - - UNI28472 - ATTAACACTTACTGCCAGAACATC

AAGGAGTTCACTGCCCAAAACTTAGGCAAACTCTTCATGGCCCAGGCTCTTCAAGAATACAATAATTAAGAAAAGGAGCCTCCTGAGAAGGCGTTGAGTA

GACAGACTGTTGAGAGGCCACAGAGTGCACTTGGAAAAACTCATTTCTGTGCTGCAAAGCAATGGTGGGGAGGCGCAGTGCCGCGACTGCTGTAGTGGTT

TCTAGCCAATAATAAAACTTTAATTGGTTGTTC
Translation
MASRKEGTGSTATSSGSAGGAVGKGKGKGGSGDSAVKQVQ - UNI643 - - UNI1410 - - UNI2356 - - UNI28472 - INTYCQNIKEF

TAQNLGKLFMAQALQEYNN
Transcript ENSMUST00000022925
Sequence
CTCTTTCTTCCTGTCTGGCTGGAAACATGGCGTCGCGCAAGGAAGGCACCGGCTCTACCGCCACCTCCTCCGGTTCTGCTGGCGGCGCGGTGGGGAAGGG

CAAAGGCAAAGGCGGCTCCGGAGATTCGGCCGTGAAGCAGGTGCAGATCGACGGCCTG - UNI2356 - GTAGTATTAAAGATAATCAAACATTATCA

AGAAGAAGGACAAGGCACTGAGGTTGTTCAGGGCGTGCTCCTGGGTCTGGTTGTGGAAGACCGGCTAGAGATTACCAACTGCTTCCCGTTCCCCCAGCAC

ACGGAGGATGATGCTGACTTTGATGAGG - UNI643 - TACAGTATCAGATGGAGATGATGCGCAGCCTTCGCCATGTCAACATTGATCACCTCCACG

TGGGCTGGTATCAGTCCACATATTACGGCTCCTTCGTTACCCGGGCGCTTCTGGATTCTCAGTTCAGCTACCAGCACGCCATTGAAGAGTCTGTCGTCCT

CATTTATG ATCCCATAAAAACTGCCCAAGGATCTCTCTCGCTGAAGGCGTACAGACTGACTCCTAAACTGATGGAAGTTTGTAAAGAGAAGGACTTTTC

CCCTGAAGC ATTGAAAAAGGCAAGCATCACCTTTGAGCACATGTTTGAAGAAGTGCCGATTGTAATTAAAAACTCACATCTGATCAATGTCCTTATGTG

GGAACTTGAGAAGAAGTCAGCTGTGGCGGATAAGCACGAATTGCTCAGTCTTGCTAGCAG CAATCATCTGGGGAAGAGCCTCCAGCTGCTGATGGACCG

GGTGGACGAAATGAGCCAGGACATAATCAAATACAACACGTACATGCGCAACACCAGTAAGCAGCAGCAGCAGAAACATCAG - UNI1410 - TATCA

GCAGCGTCGCCAACAGGAGAATATGCAGCGACAGAGTCGAGGCGAGCCCCCACTCCCTGAGGAGGACCTCTCTAAACTCTTCAAGCCCCACCAGGCCCCT

GCCAGGATGGATTCACTGCTCATTGCAG GCCAGATTAACACTTACTGCCAGAACATCAAGGAGTTCACTGCCCAAAACTTAGGCAAACTCTTCATGGCC

CAGGCTCTTCAAGAATACAATAATTAAGAAAAGGAGCCTCCTGAGAAGGCGTTGAGTAGACAGACTGTTGAGAGGCCACAGAGTGCACTTGGAAAAACTC

ATTTCTGTGCTGCAAAGCAATGGTGGGGAGGCGCAGTGCCGCGACTGCTGTAGTGGTTTCTAGCCAATAATAAAACTTTAATTGGTTGTTC
Translation
MASRKEGTGSTATSSGSAGGAVGKGKGKGGSGDSAVKQVQIDGL - UNI2356 - VVLKIIKHYQEEGQGTEVVQGVLLGLVVEDRLEITNCFPFPQH

TEDDADFDEV - UNI643 - VQYQMEMMRSLRHVNIDHLHVGWYQSTYYGSFVTRALLDSQFSYQHAIEESVVLIYD DPIKTAQGSLSLKAYRLTPK

LMEVCKEKDFSPEA ALKKASITFEHMFEEVPIVIKNSHLINVLMWELEKKSAVADKHELLSLASS SNHLGKSLQLLMDRVDEMSQDIIKYNTYMRNTS

KQQQQKHQ - UNI1410 - YQQRRQQENMQRQSRGEPPLPEEDLSKLFKPHQAPARMDSLLIAG GQINTYCQNIKEFTAQNLGKLFMAQALQEYNN

For any suggestions or comments, please send an email to unitrap@crg.es