Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000022325 (Pop1)
Chromosomal location
Chr 15: 34425087 - 34460402 (+)
Description
processing of precursor 1, ribonuclease P/MRP family, (S. cerevisiae) Gene [Source:MGI (curated);Acc:Pop1-001]
RefSeq_dna
NM_026340 NM_152894 
RefSeq_peptide
NP_080616.1 NP_690854.1 
MGI
MGI:1914974 
Uniprot/SPTREMBL
Q9D4G5 Q8K205 
Human Ortholog
ENSG00000104356 (POP1)
Omim not available
UniTrap UNI10843
Vector Insertion
Chr 15: 34425171 - 34429043
Public Clones (sanger) H009F06 (ggtc) E035E12 (ggtc) P079C01 (ggtc) E078A09 (ggtc)
D045D12 (ggtc) P089D04 (ggtc) D047C12 (ggtc) IST14279B12 (tigm) IST11468G7 (tigm)
Private Clones OST310409 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI17319
Vector Insertion
Chr 15: 34429188 - 34432065
Public Clones not available
Private Clones OST445244 (lexicon) OST347034 (lexicon) OST208848 (lexicon)
Severity of mutation (?) Insertion after 5% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI15012
Vector Insertion
Chr 15: 34432234 - 34434713
Public Clones PST14580-NR (escells)
Private Clones not available
Severity of mutation (?) Insertion after 10% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI37737
Vector Insertion
Chr 15: 34437963 - 34438358
Public Clones (ggtc)
Private Clones not available
Severity of mutation (?) Insertion after 27% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI4415
Vector Insertion
Chr 15: 34438547 - 34439517
Public Clones AD0518 (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 33% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI7242
Vector Insertion
Chr 15: 34445713 - 34447581
Public Clones RRT128 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 56% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000079028
Sequence
CTCGCTCACCCTCTGTGGTGGGAGCTTCTAGGGATCTCAGAACCTTGTCATTCTTACCGGCGAAGCCCTCGGAACTTTTGGCAG - UNI10843 - AA

ATGTCTAATGCAAAGGAAAGAAAACATGCTAAGAAAATGAGAAACCAGCCCAGTAACGTGACTCTGTCCTCCGGCTTTATGGCTGAGAGAGATGGAAAGC

ATCATTTTGGAAAGGGGAAGCCGTCCCAATCTCAGAAACAAG - UNI17319 - AGCTTCATTCTGGAACCTCAAGGCAGTGGCAAATCAAGATGAGT

CCCCACTTGCTTCCTGAGTCTGATGTGAATGAGCAATCTTCCTCCAAAACCATGTTTAAGAAAAAGGGAGGCTGGAAAGCAGGTCCTGAGGGCACTTCTC

AGGAGATCCCCAAGTATATAACTG - UNI15012 - CTTCTACTTTTGCTCAAGCACGAGCCGCTGAAATCAGTGCCATGTTAAAAGCTGTGACCCAG

AAGTCATCTAACTCACTGGTTTTCCAGACTCTTCCAAGGCACATGCGACGTAGAGCCATGAGCCACAATGTCAAACGCCTTCCTAGACGGTTGCAGGAGA

TGGCCAAAAAAGAG GCGGAGAAAGCTGCTCATCAGAAAAAAGAACATTCAAAAAATAAATGCCACAAAGCCCGAAGATGTCACATAAACCGGACTCTGG

AATTTAACCGCAGACAACAGAAGAACATATGGTTAGAGACTCACATCTGGCACGCCAAACGGTTTCATATGGTGAAGAAGTGGGGTTACTGCCTTGGGGA

GAGGCCCACGGCCAAGAGCCACCGAGCCTGCTATCGAGCCATGACAAACCTCTGCCTCCTGCAG GATTTATCATATTACTGCTGTTTGGAGTTGAAAGG

CAAAGAGGAAGAACTACTGAAAGCGCTCTCTCAAATGTGTAGCATAGACGCAG GCCTGACTTTTGCTGCAGTTCACTGCTTGTCTGGGAAGCGGCAAGG

GAGCCTCATGCTTTACCGGGCAAATAAGTATCCCAGGGAAATGCTTGGGCCGGTTACCTTCATCTGGAAGTCTAGGATGACCCCAGAGGATGCTTCTGAG

GATAGGCAGCTGTGGATCTGGCTTCACCCAACTCTTAAACTG - UNI4415 - GCTGTCCTAGAAGAAATAAAAACAACATGCCACTGTTCAGAACCC

GTCAAGTCAAATATCTGCATGCCTGACCCACTCCTGACACCAGCCCCGGAAGACATTCAAGCAGGACTAGCTGGTGACAAAATCAGCAAGAAAAGAAAAA

GGAGAGACGATGGGGAGAGTGTTAGCCGAGCTAAGAAGACCATTGGTGACGGGACACGAGATGCCTGCCAGCCTCGGTCATGGCGATCTCCCACTACAGG

GATTATAGTCAG TGACTTGACAATGGAGATGAACAGGTTCCGGCTGATAGGCCCTCTTTCGCACTGTATCCTGACCTCAGCACTGAGGGCTGCTCCTGT

ACACACA GGGGAAGAGGATGCCGAGGAGACACCACATCACTGGTGGACTGACACTTGCAGGAGCTCTGATGGTCGTTCTCTTCACCAAAGACAAGAAGC

AGTGTTTGAGTTGTTGGGAG GGATATCATCACCAGCAGAAATTCCAGCAGGTACTATTCTGGGATTGACAGTTAGGGATCCGAGAGTAAATTTGCCCCC

ACAGCGATCCAGAGCTTTGCCTGATCCAGAAAGATACCAAG CTAATGAGCGAGTGAAGCAGCTGCTTCTGGAGGGTGTGCCTGTGGCATGTGCACACAG

CTTCATCTGGGACCAGGATATCTGTAGGAGTGTCACCGAGAATAAACTCTTGGATCAG - UNI7242 - GATTTAAACCGGATGAGAAGTGAGTTGCT

GGTGCCCGGATCGCAACTTGATTTAGGGGCTCGTGAATCTAAGATACCCATACTTCTGATTCAGCAGCCAGGAAAAGTGACTGGCGAAGACCGACTGGGC

TGGGGCAGTGGCTGGGATGTCCTCATTCCCAAGGGCTGGGGCATGGCTTTTTGGATTCCATTT ATCTACCGAGGTGCACGAGTTGGTGGACTAAAAGAG

GCTACAGTGCATTCTCAATACAGACGGTCTCCTAACATCCCAGGCGATTTCCCAGACTGCCGTGCTGGAGTTCTGTTTGCTGAAGATCAAGCTAAGGATC

TTCTAGAGAAGTACAGACG ACGCCCTCCTGCTAAAAGGCCCAACTATGTTAAGCTTGGCACACTGGCTCCTTTCTGTTGTCCCTGGGAACAGCTGACTC

GGGACTGGGAGTCCAGGGTTCATGCCCAAGAGGCAGCTATTATAGCTTCAATGCCTGGTGCTCAGGAGACTGACCCAAGACGGCTTGGAGTGCCTTGTGT

CCCCAAAGAGATCTGCCAACTATCTAATGAGGCAGGCATAGCTGAAAACCAACCCAGGAAGCCAGAAGTTACAGGCTGTCAAGCGCAGGAGGGGACCAAA

GTGGCCATGGAATGGAATGCCAGTGAGGCTCATATGGCTACCACAGGTAGCCAGCTCTGTGTTGTTCG GAGTAGGAAACTGCTGAAGCAGCTCTCGTCC

TGGTGTGGGCCCAGTTCTGAGATCAGGAGGGCTCCCTGCAGAGCTCAGCAAGAACTGACTAGTAACGTCTGCTTGTCCATTCTGAATGACTTCCCCAGAG

CCCTGGTGTGGGTCAGCTTGTCCCTGCTCAGGAAGGGCAGCCCAGAGCCTCACACCATGATCTGTGTCCCATCTAAGGAGGACCTGCACCGGCTCAGTCA

GGATCAGTGCTACCATGGACCCTGGGAATCCAGACACAGCGACCCATTTAAAAGCCTGATTCTGAAGGAGAAAGAAAAGAAGAAAAAGGAGAAGAGGCAG

GATGGGGAACACAGAGCCTCCGAGGGCCAGGCCGCAGGGCCGCCCATAGCTGGGCAGGAAGCTCTGACGCAGGGGCTGTGGTCAGGCCCCCTTCCAGGAC

TAACCTCACACTGCTCCAGGCTCCTCCTAGGCTTTGTCACACAGGGAGATTTTTCTATGGCTGCTGGCTGTGGAGAAGCCTTAGGGTTTGTTAGTATGAC

CGGCTTGCTGGAAATGTTGTCCAGCCAGTCAGCAGCCATGAGGGGCCTGGTGCTGCTGCGGCCTCCAACCTCACTGCAGTATCGGTTTGCAAGAATTACC

ATTGAGGTGTGAATTTAAGTTTATAGCCTGGTCTTAAATTATAACTATTTTGGTCAAAGCTCACAGAAAGTCCTGGCTGTCTCTGTCACCATCTGATTTA

AGATATATTGTGGAACTGCGTGGAAACAAGAATTAAAATTATGTAATCATGTGG
Translation
 - UNI10843 - MSNAKERKHAKKMRNQPSNVTLSSGFMAERDGKHHFGKGKPSQSQKQE - UNI17319 - ELHSGTSRQWQIKMSPHLLPESDV

NEQSSSKTMFKKKGGWKAGPEGTSQEIPKYITA - UNI15012 - ASTFAQARAAEISAMLKAVTQKSSNSLVFQTLPRHMRRRAMSHNVKRLPRRLQ

EMAKKE AEKAAHQKKEHSKNKCHKARRCHINRTLEFNRRQQKNIWLETHIWHAKRFHMVKKWGYCLGERPTAKSHRACYRAMTNLCLLQ DLSYYCCLE

LKGKEEELLKALSQMCSIDAG GLTFAAVHCLSGKRQGSLMLYRANKYPREMLGPVTFIWKSRMTPEDASEDRQLWIWLHPTLKL - UNI4415 - AV

LEEIKTTCHCSEPVKSNICMPDPLLTPAPEDIQAGLAGDKISKKRKRRDDGESVSRAKKTIGDGTRDACQPRSWRSPTTGIIVS SDLTMEMNRFRLIGP

LSHCILTSALRAAPVHT GEEDAEETPHHWWTDTCRSSDGRSLHQRQEAVFELLGG GISSPAEIPAGTILGLTVRDPRVNLPPQRSRALPDPERYQA A

NERVKQLLLEGVPVACAHSFIWDQDICRSVTENKLLDQ - UNI7242 - DLNRMRSELLVPGSQLDLGARESKIPILLIQQPGKVTGEDRLGWGSGWD

VLIPKGWGMAFWIPF IYRGARVGGLKEATVHSQYRRSPNIPGDFPDCRAGVLFAEDQAKDLLEKYRR RRPPAKRPNYVKLGTLAPFCCPWEQLTRDWE

SRVHAQEAAIIASMPGAQETDPRRLGVPCVPKEICQLSNEAGIAENQPRKPEVTGCQAQEGTKVAMEWNASEAHMATTGSQLCVVR RSRKLLKQLSSWC

GPSSEIRRAPCRAQQELTSNVCLSILNDFPRALVWVSLSLLRKGSPEPHTMICVPSKEDLHRLSQDQCYHGPWESRHSDPFKSLILKEKEKKKKEKRQDG

EHRASEGQAAGPPIAGQEALTQGLWSGPLPGLTSHCSRLLLGFVTQGDFSMAAGCGEALGFVSMTGLLEMLSSQSAAMRGLVLLRPPTSLQYRFARITIE

V
Transcript ENSMUST00000052290
Sequence
CTCGCTCACCCTCTGTGGTGGGAGCTTCTAGGGATCTCAGAACCTTGTCATTCTTACCGGCGAAGCCCTCGGAACTTTTGGCAG - UNI10843 - AA

ATGTCTAATGCAAAGGAAAGAAAACATGCTAAGAAAATGAGAAACCAGCCCAGTAACGTGACTCTGTCCTCCGGCTTTATGGCTGAGAGAGATGGAAAGC

ATCATTTTGGAAAGGGGAAGCCGTCCCAATCTCAGAAACAAG - UNI17319 - AGCTTCATTCTGGAACCTCAAGGCAGTGGCAAATCAAGATGAGT

CCCCACTTGCTTCCTGAGTCTGATGTGAATGAGCAATCTTCCTCCAAAACCATGTTTAAGAAAAAGGGAGGCTGGAAAGCAGGTCCTGAGGGCACTTCTC

AGGAGATCCCCAAGTATATAACTG - UNI15012 - CTTCTACTTTTGCTCAAGCACGAGCCGCTGAAATCAGTGCCATGTTAAAAGCTGTGACCCAG

AAGTCATCTAACTCACTGGTTTTCCAGACTCTTCCAAGGCACATGCGACGTAGAGCCATGAGCCACAATGTCAAACGCCTTCCTAGACGGTTGCAGGAGA

TGGCCAAAAAAGAG GCGGAGAAAGCTGCTCATCAGAAAAAAGAACATTCAAAAAATAAATGCCACAAAGCCCGAAGATGTCACATAAACCGGACTCTGG

AATTTAACCGCAGACAACAGAAGAACATATGGTTAGAGACTCACATCTGGCACGCCAAACGGTTTCATATGGTGAAGAAGTGGGGTTACTGCCTTGGGGA

GAGGCCCACGGCCAAGAGCCACCGAGCCTGCTATCGAGCCATGACAAACCTCTGCCTCCTGCAG GATTTATCATATTACTGCTGTTTGGAGTTGAAAGG

CAAAGAGGAAGAACTACTGAAAGCGCTCTCTCAAATGTGTAGCATAGACGCAG GCCTGACTTTTGCTGCAGTTCACTGCTTGTCTGGGAAGCGGCAAGG

GAGCCTCATGCTTTACCGGGCAAATAAGTATCCCAGGGAAATGCTTGGGCCGGTTACCTTCATCTGGAAGTCTAGGATGACCCCAGAGGATGCTTCTGAG

GATAGGCAGCTGTGGATCTGGCTTCACCCAACTCTTAAACTG - UNI4415 - GCTGTCCTAGAAGAAATAAAAACAACATGCCACTGTTCAGAACCC

GTCAAGTCAAATATCTGCATGCCTGACCCACTCCTGACACCAGCCCCGGAAGACATTCAAGCAGGACTAGCTGGTGACAAAATCAGCAAGAAAAGAAAAA

GGAGAGACGATGGGGAGAGTGTTAGCCGAGCTAAGAAGACCATTGGTGACGGGACACGAGATGCCTGCCAGCCTCGGTCATGGCGATCTCCCACTACAGG

GATTATAGTCAG TGACTTGACAATGGAGATGAACAGGTTCCGGCTGATAGGCCCTCTTTCGCACTGTATCCTGACCTCAGCACTGAGGGCTGCTCCTGT

ACACACA GGGGAAGAGGATGCCGAGGAGACACCACATCACTGGTGGACTGACACTTGCAGGAGCTCTGATGGTCGTTCTCTTCACCAAAGACAAGAAGC

AGTGTTTGAGTTGTTGGGAG GGATATCATCACCAGCAGAAATTCCAGCAGGTACTATTCTGGGATTGACAGTTAGGGATCCGAGAGTAAATTTGCCCCC

ACAGCGATCCAGAGCTTTGCCTGATCCAGAAAGATACCAAG TTTCGGAATTTACCTGTGAGGAAGGGATGTGCACCGGCAGCTGGTCTTGTGCTCATTG

GAAGCCTCTGTCTGACCATACAGATGATCCAG CTAATGAGCGAGTGAAGCAGCTGCTTCTGGAGGGTGTGCCTGTGGCATGTGCACACAGCTTCATCTG

GGACCAGGATATCTGTAGGAGTGTCACCGAGAATAAACTCTTGGATCAG - UNI7242 - GATTTAAACCGGATGAGAAGTGAGTTGCTGGTGCCCGG

ATCGCAACTTGATTTAGGGGCTCGTGAATCTAAGATACCCATACTTCTGATTCAGCAGCCAGGAAAAGTGACTGGCGAAGACCGACTGGGCTGGGGCAGT

GGCTGGGATGTCCTCATTCCCAAGGGCTGGGGCATGGCTTTTTGGATTCCATTT ATCTACCGAGGTGCACGAGTTGGTGGACTAAAAGAGGCTACAGTG

CATTCTCAATACAGACGGTCTCCTAACATCCCAGGCGATTTCCCAGACTGCCGTGCTGGAGTTCTGTTTGCTGAAGATCAAGCTAAGGATCTTCTAGAGA

AGTACAGACG ACGCCCTCCTGCTAAAAGGCCCAACTATGTTAAGCTTGGCACACTGGCTCCTTTCTGTTGTCCCTGGGAACAGCTGACTCGGGACTGGG

AGTCCAGGGTTCATGCCCAAGAGGCAGCTATTATAGCTTCAATGCCTGGTGCTCAGGAGACTGACCCAAGACGGCTTGGAGTGCCTTGTGTCCCCAAAGA

GATCTGCCAACTATCTAATGAGGCAGGCATAGCTGAAAACCAACCCAGGAAGCCAGAAGTTACAGGCTGTCAAGCGCAGGAGGGGACCAAAGTGGCCATG

GAATGGAATGCCAGTGAGGCTCATATGGCTACCACAGGTAGCCAGCTCTGTGTTGTTCG GAGTAGGAAACTGCTGAAGCAGCTCTCGTCCTGGTGTGGG

CCCAGTTCTGAGATCAGGAGGGCTCCCTGCAGAGCTCAGCAAGAACTGACTAGTAACGTCTGCTTGTCCATTCTGAATGACTTCCCCAGAGCCCTGGTGT

GGGTCAGCTTGTCCCTGCTCAGGAAGGGCAGCCCAGAGCCTCACACCATGATCTGTGTCCCATCTAAGGAGGACCTGCACCGGCTCAGTCAGGATCAGTG

CTACCATGGACCCTGGGAATCCAGACACAGCGACCCATTTAAAAGCCTGATTCTGAAGGAGAAAGAAAAGAAGAAAAAGGAGAAGAGGCAGGATGGGGAA

CACAGAGCCTCCGAGGGCCAGGCCGCAGGGCCGCCCATAGCTGGGCAGGAAGCTCTGACGCAGGGGCTGTGGTCAGGCCCCCTTCCAGGACTAACCTCAC

ACTGCTCCAGGCTCCTCCTAGGCTTTGTCACACAGGGAGATTTTTCTATGGCTGCTGGCTGTGGAGAAGCCTTAGGGTTTGTTAGTATGACCGGCTTGCT

GGAAATGTTGTCCAGCCAGTCAGCAGCCATGAGGGGCCTGGTGCTGCTGCGGCCTCCAACCTCACTGCAGTATCGGTTTGCAAGAATTACCATTGAGGTG

TGAATTTAAGTTTATAGCCTGGTCTTAAATTATAACTATTTTGGTCAAAGCTCACAGAAAGTCCTGGCTGTCTCTGTCACCATCTGATTTAAGATATATT

GTGGAACTGCGTGGAAACAAGAATTAAAATTATGTAATCATGTGG
Translation
 - UNI10843 - MSNAKERKHAKKMRNQPSNVTLSSGFMAERDGKHHFGKGKPSQSQKQE - UNI17319 - ELHSGTSRQWQIKMSPHLLPESDV

NEQSSSKTMFKKKGGWKAGPEGTSQEIPKYITA - UNI15012 - ASTFAQARAAEISAMLKAVTQKSSNSLVFQTLPRHMRRRAMSHNVKRLPRRLQ

EMAKKE AEKAAHQKKEHSKNKCHKARRCHINRTLEFNRRQQKNIWLETHIWHAKRFHMVKKWGYCLGERPTAKSHRACYRAMTNLCLLQ DLSYYCCLE

LKGKEEELLKALSQMCSIDAG GLTFAAVHCLSGKRQGSLMLYRANKYPREMLGPVTFIWKSRMTPEDASEDRQLWIWLHPTLKL - UNI4415 - AV

LEEIKTTCHCSEPVKSNICMPDPLLTPAPEDIQAGLAGDKISKKRKRRDDGESVSRAKKTIGDGTRDACQPRSWRSPTTGIIVS SDLTMEMNRFRLIGP

LSHCILTSALRAAPVHT GEEDAEETPHHWWTDTCRSSDGRSLHQRQEAVFELLGG GISSPAEIPAGTILGLTVRDPRVNLPPQRSRALPDPERYQV V

SEFTCEEGMCTGSWSCAHWKPLSDHTDDPA ANERVKQLLLEGVPVACAHSFIWDQDICRSVTENKLLDQ - UNI7242 - DLNRMRSELLVPGSQLD

LGARESKIPILLIQQPGKVTGEDRLGWGSGWDVLIPKGWGMAFWIPF IYRGARVGGLKEATVHSQYRRSPNIPGDFPDCRAGVLFAEDQAKDLLEKYRR

 RRPPAKRPNYVKLGTLAPFCCPWEQLTRDWESRVHAQEAAIIASMPGAQETDPRRLGVPCVPKEICQLSNEAGIAENQPRKPEVTGCQAQEGTKVAMEW

NASEAHMATTGSQLCVVR RSRKLLKQLSSWCGPSSEIRRAPCRAQQELTSNVCLSILNDFPRALVWVSLSLLRKGSPEPHTMICVPSKEDLHRLSQDQC

YHGPWESRHSDPFKSLILKEKEKKKKEKRQDGEHRASEGQAAGPPIAGQEALTQGLWSGPLPGLTSHCSRLLLGFVTQGDFSMAAGCGEALGFVSMTGLL

EMLSSQSAAMRGLVLLRPPTSLQYRFARITIEV

For any suggestions or comments, please send an email to unitrap@crg.es