Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000022366 (BC026439)
Chromosomal location
Chr 15: 57075326 - 57309180 (-)
Description
BC026439 proteinPutative uncharacterized proteincDNA sequence BC026439 ;; [Source:UniProtKB/TrEMBL;Acc:Q8R0S9]
RefSeq_dna
NM_172378 
RefSeq_peptide
NP_759010.1 
UniGene
Mm.26555 
MGI
MGI:2446114 
Uniprot/SPTREMBL
Q8R0S9 
Human Ortholog
not available
Omim not available
UniTrap UNI31050
Vector Insertion
Chr 15: 57096648 - 57307958
Public Clones (sanger) IST11393B9 (tigm) IST11033E7 (tigm) IST10471G9 (tigm) IST11293E11 (tigm)
IST12093F4 (tigm) IST11278H5 (tigm) IST14453B11 (tigm) IST11742F11 (tigm)
IST11742F10 (tigm) IST14554D5 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000110196
Sequence
AGAATGCTTCGTCTAATCTAGAGAGAACAAAGAGATGATACATTCCTCTCCATATTTTCTTCCATTCGGTTGTGAACTTTGTCCAGAGAGCACTCATTAC

TTAAGGAGATAAATGGGAAAAAGATGAAATGAAATAAGGAAGTCTGATAGTGTGAGAGTCTGGACCAAGCTGCTCCAGTCCAACTTGGCCTGAGAGAAGC

AGAATGAAACTTGAGTCTGGAGGGAATATTGAAGTGGATTTTATGATGAGAGACTTGCACCATTGGGTCAG - UNI31050 - CTGCAGGATGGATCA

CACTATCCAAATTGCAGAGAATGTCCTATGCCGCATGATGGGTGAAGCTTCCCATGACTCAAGTTAGACAATCAGATCTCGTTTCAGTAGATCAAGAAGA

CATTTATAGTAGACTCTGGACATAAACAATGTGAAAGTA - UNI31050 - CATTTGCAAGAATAGCCATGGATTTTGATGAAATTCTACATCATGTA

GGTGACAGTGGAAGATTTCAGATTTGTATGATCATCCTTCTCAACATTTTATCCTTGGTGTTATCCCCTCATGATGTCCTGGAGAATTTTACAGCAGCCA

TCCCTGCTCATCACTGTAGTATAAACCTTGACAATTCAAGATCTGAAGTTAGTACTGACATGAACTTAACTACTGAAGATTTGATGAAGGTCTCCATCCC

AATGGGCCCAAATCAGAAACCCGAGCAATGCCGACGCTTTAGGTACACCCAATGGCAATTTTTAGATTCCAACATATCAACTTTTAACAGCACTGAGCTA

GAGACTGAGCCGTGTCTAGATGGATGGACATATGACCACAGTGTTTTTACTTCTACCATTGTCACTGAG TGGGATTTAGTATGTGATTTTCAGTCATTC

AAATACTATGCACAAGCCACGTCTTTGGCAGGACATTTGGTATCTTGTCCTCTATCTGGCATTATTTCTGACAG GTTTGGAAGGAAGCCATTGTTGATG

TATTGTTCCCTAGCCTATGGGGCTGTGGGAACCTACTGTGCCTTTGCCCCCAATTTCTCCGTTTACTGTGTTTTGAGATTCCTGTTATCTGCCTTCCAAA

GTACTATTTTGATCAACTCTCTTATCCTTG TTTTGGAAGAAGCATCAGTCCAGTGGCACCCCACAATCATAGTACTCAGTGGACTGTTCAACAGTATTG

GCCAGGGTGTACTTGGGGGACTAGCCTATGTGATTTCGGATTGGCACTTACTTCAACTTGCATATGCCTTGCCCTTCTTCATCTTTTTTGTTTTGTTCTG

 CTGGGTGCCAGAATCAGTCCGGTGGCTCATAATCACTGGCAAAACAGATCAAGCATGGAAGGAACTCCAGAGAATTGCCTCCATCAATGGGAAGAAAGG

CATTGCACAAAATCTAACTACTGAG GACTTGCGATCCAAACTTAAGAAAGATGTGAATTCAACTGGAAAGCTTTTCAGAATAAAGGACATCTTTATTAA

TCCCTTGATACGTAAAATAGTGCTTTCGAATTCCAGTTTACT TTTTGCAGAACTTTTCAGCTTTGTTGGCCTCTTGTTGGATGTTCAACTGTTGGGAAA

GAACATGTTCTTGACCCAGATTTTTCTAGGAGCGATAGACGTGCCCAGTAAATCACTCACATATTTTACAATAAGAAATGTAAGCCGTCGTCCTTTAATT

GCTTTTTTGCTACTTACAACTGGAAGTTGTATTACCATCACCATATTCATCTCTGAAG AGATGTATGTCCTGCGTACTATTATTTTCATTTTGGGAAAA

GGATGTTTTGCAGCTTTCACTTGTATAAGCACAACCTACATCAATGAACTCTCACCAGTAGAACTCAG GTCAACTCTAAATGGTGTTTTTTTAGCTGTT

GTTCGATTGGCAGGGGTCCTGTCTGCACTAACACTTGCTACTAGAAAGTATTTTGTATATCTTCCCATGATACTCTATGGAGTCCTACCCATCGTGGCAA

CAATCAGCATCCTCTTTCTGCCAGAGACCTTTAACCTTCCACATACTGACATTATCAAGGATATGGAGAAAAG GAAAAGATTGATGAGCAAAAACATCA

GTAAAAAAGAAGGGCAAGACTTCTTGGAAACTACCGAGTGCTAAAGAGAGTCAAGATCCACAGGGTTCCATCCATATAAAGACTCTTTATTCTGTCCTGT

ACCCTAGAGACTTTACCCATTGATCAGCAGTTACGGATATATTTATTAAATGAAGCTACTGCAAAAGTAAATCTCTTAGCCAATCCGTTATATAGATGCA

AGTCCTAAGGTTTTTATCAAATACTGGAGTACAATCCCCTTTCATAAAAAATGTGAGAATAAATCTGTGCAACAACAACAACAAAAATAAACAAAAAGAA

AAACC
Translation
 - UNI31050 -  - UNI31050 - MDFDEILHHVGDSGRFQICMIILLNILSLVLSPHDVLENFTAAIPAHHCSINLDNSRSEVSTDMNLTTEDLM

KVSIPMGPNQKPEQCRRFRYTQWQFLDSNISTFNSTELETEPCLDGWTYDHSVFTSTIVTE WDLVCDFQSFKYYAQATSLAGHLVSCPLSGIISDR RF

GRKPLLMYCSLAYGAVGTYCAFAPNFSVYCVLRFLLSAFQSTILINSLILV VLEEASVQWHPTIIVLSGLFNSIGQGVLGGLAYVISDWHLLQLAYALP

FFIFFVLFC CWVPESVRWLIITGKTDQAWKELQRIASINGKKGIAQNLTTE DLRSKLKKDVNSTGKLFRIKDIFINPLIRKIVLSNSSLL LFAELFS

FVGLLLDVQLLGKNMFLTQIFLGAIDVPSKSLTYFTIRNVSRRPLIAFLLLTTGSCITITIFISEE EMYVLRTIIFILGKGCFAAFTCISTTYINELSP

VELR RSTLNGVFLAVVRLAGVLSALTLATRKYFVYLPMILYGVLPIVATISILFLPETFNLPHTDIIKDMEKR RKRLMSKNISKKEGQDFLETTEC
Transcript ENSMUST00000022995
Sequence
CTTTTGGTAAAGAGACATAGCTATTCTCTATGTGTGATTTGGCTGTGTGCAACAGAAGTCCTATATAG - UNI31050 - CATTTGCAAGAATAGCCA

TGGATTTTGATGAAATTCTACATCATGTAGGTGACAGTGGAAGATTTCAGATTTGTATGATCATCCTTCTCAACATTTTATCCTTGGTGTTATCCCCTCA

TGATGTCCTGGAGAATTTTACAGCAGCCATCCCTGCTCATCACTGTAGTATAAACCTTGACAATTCAAGATCTGAAGTTAGTACTGACATGAACTTAACT

ACTGAAGATTTGATGAAGGTCTCCATCCCAATGGGCCCAAATCAGAAACCCGAGCAATGCCGACGCTTTAGGTACACCCAATGGCAATTTTTAGATTCCA

ACATATCAACTTTTAACAGCACTGAGCTAGAGACTGAGCCGTGTCTAGATGGATGGACATATGACCACAGTGTTTTTACTTCTACCATTGTCACTGAG T

GGGATTTAGTATGTGATTTTCAGTCATTCAAATACTATGCACAAGCCACGTCTTTGGCAGGACATTTGGTATCTTGTCCTCTATCTGGCATTATTTCTGA

CAG GTTTGGAAGGAAGCCATTGTTGATGTATTGTTCCCTAGCCTATGGGGCTGTGGGAACCTACTGTGCCTTTGCCCCCAATTTCTCCGTTTACTGTGT

TTTGAGATTCCTGTTATCTGCCTTCCAAAGTACTATTTTGATCAACTCTCTTATCCTTG TTTTGGAAGAAGCATCAGTCCAGTGGCACCCCACAATCAT

AGTACTCAGTGGACTGTTCAACAGTATTGGCCAGGGTGTACTTGGGGGACTAGCCTATGTGATTTCGGATTGGCACTTACTTCAACTTGCATATGCCTTG

CCCTTCTTCATCTTTTTTGTTTTGTTCTG CTGGGTGCCAGAATCAGTCCGGTGGCTCATAATCACTGGCAAAACAGATCAAGCATGGAAGGAACTCCAG

AGAATTGCCTCCATCAATGGGAAGAAAGGCATTGCACAAAATCTAACTACTGAG GACTTGCGATCCAAACTTAAGAAAGATGTGAATTCAACTGGAAAG

CTTTTCAGAATAAAGGACATCTTTATTAATCCCTTGATACGTAAAATAGTGCTTTCGAATTCCAGTTTACT TTTTGCAGAACTTTTCAGCTTTGTTGGC

CTCTTGTTGGATGTTCAACTGTTGGGAAAGAACATGTTCTTGACCCAGATTTTTCTAGGAGCGATAGACGTGCCCAGTAAATCACTCACATATTTTACAA

TAAGAAATGTAAGCCGTCGTCCTTTAATTGCTTTTTTGCTACTTACAACTGGAAGTTGTATTACCATCACCATATTCATCTCTGAAG AGATGTATGTCC

TGCGTACTATTATTTTCATTTTGGGAAAAGGATGTTTTGCAGCTTTCACTTGTATAAGCACAACCTACATCAATGAACTCTCACCAGTAGAACTCAG GT

CAACTCTAAATGGTGTTTTTTTAGCTGTTGTTCGATTGGCAGGGGTCCTGTCTGCACTAACACTTGCTACTAGAAAGTATTTTGTATATCTTCCCATGAT

ACTCTATGGAGTCCTACCCATCGTGGCAACAATCAGCATCCTCTTTCTGCCAGAGACCTTTAACCTTCCACATACTGACATTATCAAGGATATGGAGAAA

AG GAAAAGATTGATGAGCAAAAACATCAGTAAAAAAGAAGGGCAAGACTTCTTGGAAACTACCGAGTGCTAAAGAGAGTCAAGATCCACAGGGTTCCAT

CCATATAAAGACTCTTTATTCTGTCCTGTACCCTAGAGACTTTACCCATTGATCAGCAGTTACGGATATATTTATTAAATGAAGCTACTGCAAAAGTAAA

TCTCTTAGCCAATCCGTTATATAGATGCAAGTCCTAAGGTTTTTATCAAATACTGGAGTACAATCCCCTTTCATAAAAAATGTGAGAATAAATCTGTGC
Translation
 - UNI31050 - MDFDEILHHVGDSGRFQICMIILLNILSLVLSPHDVLENFTAAIPAHHCSINLDNSRSEVSTDMNLTTEDLMKVSIPMGPNQKPEQ

CRRFRYTQWQFLDSNISTFNSTELETEPCLDGWTYDHSVFTSTIVTE WDLVCDFQSFKYYAQATSLAGHLVSCPLSGIISDR RFGRKPLLMYCSLAYG

AVGTYCAFAPNFSVYCVLRFLLSAFQSTILINSLILV VLEEASVQWHPTIIVLSGLFNSIGQGVLGGLAYVISDWHLLQLAYALPFFIFFVLFC CWVP

ESVRWLIITGKTDQAWKELQRIASINGKKGIAQNLTTE DLRSKLKKDVNSTGKLFRIKDIFINPLIRKIVLSNSSLL LFAELFSFVGLLLDVQLLGKN

MFLTQIFLGAIDVPSKSLTYFTIRNVSRRPLIAFLLLTTGSCITITIFISEE EMYVLRTIIFILGKGCFAAFTCISTTYINELSPVELR RSTLNGVFL

AVVRLAGVLSALTLATRKYFVYLPMILYGVLPIVATISILFLPETFNLPHTDIIKDMEKR RKRLMSKNISKKEGQDFLETTEC

For any suggestions or comments, please send an email to unitrap@crg.es