Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000022390 (Zc3h7b)
Chromosomal location
Chr 15: 81575278 - 81626699 (+)
Description
zinc finger CCCH type containing 7B Gene [Source:MGI Symbol;Acc:MGI:1328310]
RefSeq_dna
NM_001081016 
RefSeq_peptide
NP_001074485.1 
UniGene
Mm.432075 
MGI
MGI:1328310 
Uniprot/SPTREMBL
Q3TZP6 Q3UGE6 Q6ZPZ8 Q3TAC6 
Human Ortholog
ENSG00000100403 (ZC3H7B)
Omim not available
UniTrap UNI21229
Vector Insertion
Chr 15: 81598484 - 81599262
Public Clones not available
Private Clones OST337840 (lexicon)
Severity of mutation (?) Insertion after 2% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI21810
Vector Insertion
Chr 15: 81599428 - 81599612
Public Clones not available
Private Clones OST317177 (lexicon) OST100646 (lexicon)
Severity of mutation (?) Insertion after 3% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI33734
Vector Insertion
Chr 15: 81599612 - 81602167
Public Clones IST12726C9 (tigm) IST10664B10 (tigm) IST10614D3 (tigm) IST12478B6 (tigm)
IST10338E7 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 10% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI3277
Vector Insertion
Chr 15: 81602939 - 81603715
Public Clones AG0427 (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 18% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI9229
Vector Insertion
Chr 15: 81613637 - 81616311
Public Clones RRC225 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 66% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000109554
Sequence
GGTGGAAAAACAAAACAGAGGTCGGTCCAGCATCCGCCCAGAAATGCAGAACTGCTAGAAGGAAATCCCAGAAAAGGAAGAGCAGTTTTAAAAGAAAATC

AAGGTGAATTCCAGGCATCCCTCCACTGGGAAGGGGGGCTTGCCGACTCCCCCCTCCCCCCCAGGTGCGCAGCCCGCGCCGCCCACCCCGGGCGCGACTA

AAGCGAGGAGGAGCTGCGCTCTCTAGGACCCGAGGAGGGAGAGCTGCAGGGAGACGGAGCCTCCAGCGGGTGCTGCCGCGAGCGGCCGGCCGAGGGGGCT

GGAAATGAAAGTAAAGCGCTCCGGAGCCACATGGACCGAGCTGCCCGGGCGGCGGCGCCGGGAGCAGGATGCGGCCGCCCGTAATTAAATAGCATTTACT

CTTATTATTACTAATAATAATAACGTAATCATACCTCTAGTCATAGCATACCATTTATCGGGCTCGGCGCAGGCCCGCGGGGAGCGCAGCCCGGCCGAG 

ACACTGATGGAGAGGCAGAAACGGAAGGCGGACATCGAGAAGGGGCTGCAGTTCATCCA - UNI21229 - GTCAACACTACCCCTGAAGCAAGAGGA

GTATGAG GCTTTCCTGCTCAAGCTTGTGCAGAACCTGTTTGCCGAGGGCAACGACCTGTTCCGGGAGAAGGACTACAAGCAGGCTCTGGTGCAGTACAT

GGAAGGGCTGAACGTGGCTGACTACGCCGCCTCTGACCAGGTGGCTCTACCCCGGGAGCTGCTGTGCAAACTGCATGTCAACAGGGCAGCCTGCTACTTC

ACCATG - UNI21810 - - UNI33734 - GGCCTGTATGAGAAGGCGCTGGAGGACAGTGAGAAGGCTTTGGGCCTGGATGGCGAGAGTATCCGGG

CACTGTTCCGCAAGGCGCGCGCCCTCAACGAGCTGGGGCGCCACAAAGAGGCCTATGAATGCAGCAGCCGGTGCTCCCTCGCGCTTCCCCAC GATGAAA

ATGTCACCCAGCTGGGCCAGGAGCTGGCTCAGAAGCTTGGACTGCGGGTACGGAAAGCCTATAAGAGACCCCAG - UNI3277 - GAATTGGAAACGT

TTTCTCTGCTTAGTAATGGCGCTCCAGCTGGCTTAACAGATCAG GGAACTTCTAACGGATTGGGATCTATAGATGACATCGAAACAG ACTGCTACGTG

GATCTCCGAGGCTCCCCAGCCCTGCTCCCCTCCACTCCCACGATGCCCCTGTTCCCTCATGTTCTGGACCTCCTGGCCCCACTGGATGGCAGCAGCAGGA

CACTCCCCGGCACCGAGGGCCTAGATGACTTCTCAGATGGGGATGTGTTTGGTCCAGAACTGGACACCCTCCTGGACTCTCTG TCTCTGGTCCAGGGTG

GCCTGCCTGGCAGTGGTATGCCTAGTGAGCTGCCTCAGCTGATCCCCGTGTTTCCTGGTGGGACCCCACTCTTGCCACCTGTGGTGGGTGGCTCCATCCC

CGTGTCCAGCCCACTGCCTCCTGCCTCCTTTGGCCTTGTCATGGACCCCTCCAGGAAGCTGGCTGCTTCTGTGCTGGATGCCCTTGACTCTCCAGGGCCC

ACGCTGGACCCCCTGGATCTGTTACCATACTCTGAGGCTCGGCTGGGTGCCCTTGACAGCTTTGGGTCAGCCCGAGGCTCCCTGGACAAGCCGGACTCCT

TCCTAG AAGAGACCAGCTCGCAGGACCACCGACCCCCAAGCAGTACTCAGAAGCCAGCCCCCTCG CCGGAGCCCTCAATGCCCAACACCACCCTGCTC

ATCAAGAACCCTCTGGCTGCCACCCACGAGTTCAAGCAGGCCTGCCAGTTGTGCTACCCCAAAACAG GCCCCAGGGCTGGCGACTATACCTACCGTGAG

GGCCTCGAGCACAAGTGCAGAAGGGACGTCCTCCTCGGCCGCCTCCGGAGTTCCGAGAACCAGATCTGGAAGCGCATCCGGCCGCGGCCCACCAAAACCA

GCTTTGTGGGCTCCTACTACCTGTGCAAAG ACATGATTAACAAGCAAGACTGTAAGTACGGGGATAACTGCACCTTCGCCTACCATCAGGAGGAGATCG

ATGTGTGGACAGAGGAGCGGAAGGGCACACTCAACCGGGACCTGCTCTTTGACCCTCTAGGGGGTGTCAAGCGTGGCAGCCTCACCATTGCCAAGCTCCT

GAAGGAGCACCAGGGCATCTTCACCTTCCTCTGTGAG ATCTGCTTCGACAGCAAGCCCCGGATCATCAGCAAAGGGACCAAGGACTCTCCATCTGTCTG

CTCCAACCTGGCTGCCAAGCACAGCTTTTACAACAACAA GTGCCTGGTGCACATCGTCCGCTCCACCTCTCTCAAGTACTCCAAGATCCGTCAGTTCCA

GGAGCACTTCCAGTTTGACGTGTGCCGCCACGAGGTGCGCTATGGTTGCCTGCGCGAGGACAGCTGCCACTTCGCCCATAGTTTCATTGAGCTCAAGGTC

TGGTTGCTGCAGCAGTACTCAG - UNI9229 - GAATGACCCATGAAGACATCGTTCAGGAATCCAAGAAATACTGGCAACAGATGGAAGCCCACGCA

GGGAAGGCCAGCAGCGGCTTG GGTGCCCCAAGGACACACGGACCCAGCACTTTTGACCTGCAGATGAAGTTTGTGTGCGGTCAGTGTTGGAGGAATGGG

CAGGTGGTAGAGCCGGACAAGGACCTCAAGTACTGCAGTGCCAAGGCCCGGCATTG CTGGACCAAGGAGAGGCGGGTCCTTCTGGTGATGTCCAAGGCC

AAGAGGAAATGGGTGTCCGTGAGGCCGCTGCCATCCATTCGAAACTTCCCACAGCAATATGAC CTATGTATTCATGCCCAGAACGGCCGCAAATGCCAG

TATGTGGGGAACTGCTCCTTCGCACACAGCCCTGAGGAGAGGGACATGTGGACCTTCATGAAGGAGAACAAGA TCCTGGATATGCAACAGACCTATGAC

ATGTGGCTGAAGAAACACAACCCAGGGAAGCCGGGAGAAGGGACCCCCATCAGCTCTCGGGAAGGAGAGAAGCAGATCCAGATGCCCACAGACTATGCTG

ACATCATG ATGGGCTACCACTGCTGGCTCTGCGGCAAGAACAGCAACAGCAAGAAACAGTGGCAGCAGCACATTCAGTCTGAGAAGCACAAGGAGAAGG

TCTTCACTTCTGACAGCGACGCCAGCGGCTGGGCCTACCGCTTCCCCATGGGCGAGTTCCGACTCTGTGACAG GCTCCAGAAGGGCAAGGCCTGCCCAG

ACGGAGACAAGTGCCGTTGTGCCCATGGACAAGAGGAACTCAACGAGTGGCTGGACCGGCGTGAGGTGCTGAAGCAAAAGCTTGCCAAGGCCCGCAAGGA

CATGCTTCTGTGTCCACGGGATGATGACTTCGGCAAATACAACTTCCTGCTGCAAGAGGACGGGGACACCACTGGTGCCACCCCAGATGCCCCTGTTGCT

GCAACTGCTACTGCTGCCACCACCACCACTGGGGAGTAGGGCCAGGTCTCAGCTATGGCAAAGTCTTGGGGTCGGGGGTGGGTTGGGGGCAGGGGACTAC

CCCATCAGGCAGGCGCCAGTCCGCTGGGTCCCTGTCCATCCTTTCCACCCCCAGTACCCCAGGTGTGTATACCCAGGTCATACACTGCAACCCCAAGTGG

TCCCAGGATCCTTGGCCTGTCAAAATGGGGGCAGACCCTCCCCAATTCTAGTTCTCCTGGTTGGAGAGGGAGGGGCCTGGCCAGCTTCAGCCTACAGCTT

TAAATTCTGTCTGCTCCTAAATGGGTCCAAAGCTCAGTACTGGGGAGCCTGGGGTCCCCACTTGAATGTGCAGCAGGAGGTCCTTTTCCTTCTCTACCTT

CCTCTTCTCCCTTTCCCTGGGGCCAGATCAGGACACAGCACAGGGCAGGAGGCCCTGCCTAGCTTAAAGTATAGTCATGAGATGGAGTTGGGAGCACTAT

ACTGGTCACTTACCACCTGGGGCCTCAGTTTCCTGATCTGCGAAAGGGGCAAGGGCTAAGGCAGATGATAATCTGAAGCTAGATTAAACAGTCTAGGTGC

TCCTAACAACCACCCCCTGCCCGGGCCTCTCCTTTGTGAGCCACAGTTGTAGACCGTACCTCAGCCTTGGAGTCAACACAGCCCACAGCCCATTTTACAG

AAACCAAAACTGAGTTCTAACAGGAGGAGTGATTTGCCCAGGGTTTTTAGCCCTCTCTGGTACAGAACTGGGATGTGAACATTGGTCAGAGACCCCACCC

ATTAGTAGCTGGAGCCTCTGGGCTCCTCAGTCCCATGCAACATCCCTGGGACCTGGGGAAGGGATGCTGAGACACAAGCAGGTCTTCTTAGCTCCATGTT

GGGAGATGTTGGGGTAAGCAATGGAGGCTATATCCTCAAGAGCTGTCACAGACAAGTGGCAGAATACAGGCACCATGAGCTCAGGTTCTGACAAGGTGCA

AAGCGTGGGGAGGCTCTGAGGAATATGAAGAGTGGGAAGGCGGCCTAGGCTCCATGGGCCACTATGAGAAATAGCCTCTCTTTCCTGGGAACCCTCTGTG

GTCCTCTCTAAAAGACCCAGATATACTGTTATGGCCATCTATCCCAGCCCCTTCCACCCTATGCTCAACCCTGCTGGCTGCCTAGGACCCCAGCGGACAC

CCCCCCCCCCAGCTCATGCCCCCTTTTACCAAGGCCTCTTTTATCTTCTGAAGTATGTCTGCACCTTTCCCCCACCCCCACAGGTAGACACAGCCTCCCC

TGGCTACCCAAGACATTCCAGAATGCTCCACCCTATTGGCACAAGAAGTGGGGCACCCCCCCCCAGAAGGAACCAGAAACTAAGGCTATCAAGGAGTGAG

ATAGAATGAAGACACTCCTATTTCTCCTCCAGCCAGGGTTGCTAGAGCTCAAGGGCACAGTGATAGGCACCTGGGCATAAAGGACCCACCCACCCACCCC

TCATCCTGCCACTGCCCAACCTTCTCCTGATAACCATGGCATGCACCGTCTCCTCTCCCCTGCCCCTCTTCCCTGACCCCAGCTGGCTAGCACTGCAGAG

TTTGGCTGCTGGCAGTGTGGCTGGAGGGGAGGGGAGACCACATCTAAGGTGGGGGCCATGGCCGTGAATGTGGATGACACTTGTTCTCCTGACCCGTGGT

GTTGCAGTCTGTTGTCACCAGCCTTGTTTTAGTGTGTATATATGTCGCCCCTGTGATGCATATATACACAGGTATTAAATATATCGCTCTATATAATATT

ATATATGTGTGTGGTATCCAAGGAATCTCTTCTATTGAGGGCTAAAGATAAAGAATTTGGCACACAAAAAAAATGCAGACATCCTTGTGAATTTTGAGTG

CTTATGGGGTCATCTGGTTATTTAGGGCATTGAGACTGGAGCCGTGGCTCAGATGATTGGGGCAGAAAAGGCAGGGTGGCCCACACCTGCTCTGACTGCT

AGCTTCCCACAGATCCATGTCTAGAATACCAGTGTGCTCAGGAAAAGGAAGTCATTTCGTGTTTGTTTCCCACCAAAGAAGAATGAATCCAGGGTTTTTC

TACTGTTCGTCTGTCCAGGGGTCCCTGAGATCTGGGCTCCCTTACATTCTAGACCTATGTCCCCCCCCATGGAAGAGAAGAGAAGAATGATAGGGATGAC

CTGGGGTGGGGGGACAGCAAAACATCTTAAATGATGACTGTAGTTAATCAGATGTGACCCCTCTAGGGCCCCTGGTTGGAAGGCTCAGGGTTGAAGCGGG

GCCTAGGAGCAAGAACAAGATTGCACAGTAGACATGGGGTGAGGGTAGTGGGAGGGAATGCTGCATTTCTCAGCTGGGCAGTAATCAATCTAATGGTCCT

TTAAAAATGTCTGTATTAAAATTTAAGAATACCACACTTTAATATTAAATATCATAAGGTCTAGTATCTTGATAATAATGTAGATGTTTTAATAACAATT

TTTGTCCTTCTTAAAATAAAATGAGAGAAATTTGCTTCTTTTA
Translation
 MERQKRKADIEKGLQFIQ - UNI21229 - QSTLPLKQEEYE AFLLKLVQNLFAEGNDLFREKDYKQALVQYMEGLNVADYAASDQVALPRELLCK

LHVNRAACYFTM - UNI21810 - - UNI33734 - GLYEKALEDSEKALGLDGESIRALFRKARALNELGRHKEAYECSSRCSLALPH DENVTQL

GQELAQKLGLRVRKAYKRPQ - UNI3277 - ELETFSLLSNGAPAGLTDQ GTSNGLGSIDDIETD DCYVDLRGSPALLPSTPTMPLFPHVLDLLAP

LDGSSRTLPGTEGLDDFSDGDVFGPELDTLLDSL SLVQGGLPGSGMPSELPQLIPVFPGGTPLLPPVVGGSIPVSSPLPPASFGLVMDPSRKLAASVLD

ALDSPGPTLDPLDLLPYSEARLGALDSFGSARGSLDKPDSFLE EETSSQDHRPPSSTQKPAPS PEPSMPNTTLLIKNPLAATHEFKQACQLCYPKTG 

GPRAGDYTYREGLEHKCRRDVLLGRLRSSENQIWKRIRPRPTKTSFVGSYYLCKD DMINKQDCKYGDNCTFAYHQEEIDVWTEERKGTLNRDLLFDPLG

GVKRGSLTIAKLLKEHQGIFTFLCE ICFDSKPRIISKGTKDSPSVCSNLAAKHSFYNNK KCLVHIVRSTSLKYSKIRQFQEHFQFDVCRHEVRYGCLR

EDSCHFAHSFIELKVWLLQQYSG - UNI9229 - GMTHEDIVQESKKYWQQMEAHAGKASSGL GAPRTHGPSTFDLQMKFVCGQCWRNGQVVEPDKD

LKYCSAKARHC CWTKERRVLLVMSKAKRKWVSVRPLPSIRNFPQQYD LCIHAQNGRKCQYVGNCSFAHSPEERDMWTFMKENKI ILDMQQTYDMWLK

KHNPGKPGEGTPISSREGEKQIQMPTDYADIM MGYHCWLCGKNSNSKKQWQQHIQSEKHKEKVFTSDSDASGWAYRFPMGEFRLCDR RLQKGKACPDG

DKCRCAHGQEELNEWLDRREVLKQKLAKARKDMLLCPRDDDFGKYNFLLQEDGDTTGATPDAPVAATATAATTTTGE
Transcript ENSMUST00000096328
Sequence
GGTGGAAAAACAAAACAGAGGTCGGTCCAGCATCCGCCCAGAAATGCAGAACTGCTAGAAGGAAATCCCAGAAAAGGAAGAGCAGTTTTAAAAGAAAATC

AAGGTGAATTCCAGGCATCCCTCCACTGGGAAGGGGGGCTTGCCGACTCCCCCCTCCCCCCCAGGTGCGCAGCCCGCGCCGCCCACCCCGGGCGCGACTA

AAGCGAGGAGGAGCTGCGCTCTCTAGGACCCGAGGAGGGAGAGCTGCAGGGAGACGGAGCCTCCAGCGGGTGCTGCCGCGAGCGGCCGGCCGAGGGGGCT

GGAAATGAAAGTAAAGCGCTCCGGAGCCACATGGACCGAGCTGCCCGGGCGGCGGCGCCGGGAGCAGGATGCGGCCGCCCGTAATTAAATAGCATTTACT

CTTATTATTACTAATAATAATAACGTAATCATACCTCTAGTCATAGCATACCATTTATCGGGCTCGGCGCAGGCCCGCGGGGAGCGCAGCCCGGCCGAG 

ACACTGATGGAGAGGCAGAAACGGAAGGCGGACATCGAGAAGGGGCTGCAGTTCATCCA - UNI21229 - GTCAACACTACCCCTGAAGCAAGAGGA

GTATGAG - UNI21810 - CTTGTGCAGAACCTGTTTGCCGAGGGCAACGACCTGTTCCGGGAGAAGGACTACAAGCAGGCTCTGGTGCAGTACATGG

AAGGGCTGAACGTGGCTGACTACGCCGCCTCTGACCAGGTGGCTCTACCCCGGGAGCTGCTGTGCAAACTGCATGTCAACAGGGCAGCCTGCTACTTCAC

CATG - UNI21810 - - UNI33734 - GGCCTGTATGAGAAGGCGCTGGAGGACAGTGAGAAGGCTTTGGGCCTGGATGGCGAGAGTATCCGGGCA

CTGTTCCGCAAGGCGCGCGCCCTCAACGAGCTGGGGCGCCACAAAGAGGCCTATGAATGCAGCAGCCGGTGCTCCCTCGCGCTTCCCCAC GATGAAAAT

GTCACCCAGCTGGGCCAGGAGCTGGCTCAGAAGCTTGGACTGCGGGTACGGAAAGCCTATAAGAGACCCCAG - UNI3277 - GAATTGGAAACGTTT

TCTCTGCTTAGTAATGGCGCTCCAGCTGGCTTAACAGATCAG GGAACTTCTAACGGATTGGGATCTATAGATGACATCGAAACAG ACTGCTACGTGGA

TCTCCGAGGCTCCCCAGCCCTGCTCCCCTCCACTCCCACGATGCCCCTGTTCCCTCATGTTCTGGACCTCCTGGCCCCACTGGATGGCAGCAGCAGGACA

CTCCCCGGCACCGAGGGCCTAGATGACTTCTCAGATGGGGATGTGTTTGGTCCAGAACTGGACACCCTCCTGGACTCTCTG TCTCTGGTCCAGGGTGGC

CTGCCTGGCAGTGGTATGCCTAGTGAGCTGCCTCAGCTGATCCCCGTGTTTCCTGGTGGGACCCCACTCTTGCCACCTGTGGTGGGTGGCTCCATCCCCG

TGTCCAGCCCACTGCCTCCTGCCTCCTTTGGCCTTGTCATGGACCCCTCCAGGAAGCTGGCTGCTTCTGTGCTGGATGCCCTTGACTCTCCAGGGCCCAC

GCTGGACCCCCTGGATCTGTTACCATACTCTGAGGCTCGGCTGGGTGCCCTTGACAGCTTTGGGTCAGCCCGAGGCTCCCTGGACAAGCCGGACTCCTTC

CTAG AAGAGACCAGCTCGCAGGACCACCGACCCCCAAGCAGTACTCAGAAGCCAGCCCCCTCG CCGGAGCCCTCAATGCCCAACACCACCCTGCTCAT

CAAGAACCCTCTGGCTGCCACCCACGAGTTCAAGCAGGCCTGCCAGTTGTGCTACCCCAAAACAG GCCCCAGGGCTGGCGACTATACCTACCGTGAGGG

CCTCGAGCACAAGTGCAGAAGGGACGTCCTCCTCGGCCGCCTCCGGAGTTCCGAGAACCAGATCTGGAAGCGCATCCGGCCGCGGCCCACCAAAACCAGC

TTTGTGGGCTCCTACTACCTGTGCAAAG ACATGATTAACAAGCAAGACTGTAAGTACGGGGATAACTGC - UNI9229 - AACCTTCTCCTGATAAC

CATGGCATGCACCGTCTCCTCTCCCCTGCCCCTCTTCCCTGACCCCAGCTGGCTAGCACTGCAGAGTTTGGCTGCTGGCAGTGTGGCTGGAGGGGAGGGG

AGACCACATCTAAGGTGGGGGCCATGGCCGTGAATGTGGATGACACTTGTTCTCCTGACCCGTGGTGTTGCAGTCTGTTGTCACCAGCCTTGTTTTAG
Translation
 MERQKRKADIEKGLQFIQ - UNI21229 - QSTLPLKQEEYE - UNI21810 - LVQNLFAEGNDLFREKDYKQALVQYMEGLNVADYAASDQVA

LPRELLCKLHVNRAACYFTM - UNI21810 - - UNI33734 - GLYEKALEDSEKALGLDGESIRALFRKARALNELGRHKEAYECSSRCSLALPH

 DENVTQLGQELAQKLGLRVRKAYKRPQ - UNI3277 - ELETFSLLSNGAPAGLTDQ GTSNGLGSIDDIETD DCYVDLRGSPALLPSTPTMPLFP

HVLDLLAPLDGSSRTLPGTEGLDDFSDGDVFGPELDTLLDSL SLVQGGLPGSGMPSELPQLIPVFPGGTPLLPPVVGGSIPVSSPLPPASFGLVMDPSR

KLAASVLDALDSPGPTLDPLDLLPYSEARLGALDSFGSARGSLDKPDSFLE EETSSQDHRPPSSTQKPAPS PEPSMPNTTLLIKNPLAATHEFKQACQ

LCYPKTG GPRAGDYTYREGLEHKCRRDVLLGRLRSSENQIWKRIRPRPTKTSFVGSYYLCKD DMINKQDCKYGDNC - UNI9229 - NLLLITMAC

TVSSPLPLFPDPSWLALQSLAAGSVAGGEGRPHLRWGPWP

For any suggestions or comments, please send an email to unitrap@crg.es