Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000022420 (Dnalc4)
Chromosomal location
Chr 15: 79591893 - 79604887 (-)
Description
dynein, axonemal, light chain 4 Gene [Source:MGI Symbol;Acc:MGI:1859217]
RefSeq_dna
NM_017470 
RefSeq_peptide
NP_059498.2 
UniGene
Mm.288159 
MGI
MGI:1859217 
Uniprot/SWISSPROT
Q9DCM4 
Uniprot/SPTREMBL
Q8CDT8 
Human Ortholog
ENSG00000100246 (DNAL4)
Omim not available
UniTrap UNI18033
Vector Insertion
Chr 15: 79595452 - 79604788
Public Clones D109E11 (ggtc) IST14640C1 (tigm)
Private Clones OST431636 (lexicon) OST91617 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI18634
Vector Insertion
Chr 15: 79592956 - 79593939
Public Clones not available
Private Clones OST418904 (lexicon)
Severity of mutation (?) Insertion after 49% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000023055
Sequence
GACTTCCGTGATGGTTGCTAAGACACTCTGGCTCGCTCCTTGACAACCCTGGCGGGGGTGCGCTGGCTGTGGCCTCGGCTCCGGCCCCCGCGGGAGCAG 

- UNI18033 - CACCCCTTGGGGAAAGACATTTTCTGCTCCTGCCAAGTTGGCAAGGCCTGCTTCCCGAGCCCGTGGGGCGCTGTAACTGTTGGGCCC

AGCACCTCCTGAAAGCCCTACTCTCCTCCTGAGGGCACGCTGGGAGGATCATGGGAGAGACTGAAGGGAAGAAAGAGGAGGCTGACTATAAACGGCTGCA

GACCTTCCCCCTGGTCAGG CACTCGGACATGCCAGAGGAGATGCGCGTGGAGACCATGGAGCTGTGTGTCACAGCCTGTGAGAAATTCTCCAACAACAA

TGAG - UNI18634 - AGTGCTGCAAAGATGATCAAGGAGACAATGGACAAGAAGTTCGGCTCCTCCTGGCATGTGGTGATCGGCGAGGGGTTTGGGT

TTGAGATCACCCACGAGGTGAAGAACCTCCTGTACCTGTACTTCGGGGGGACCCTGGCCGTGTGTGTGTGGAAGTGCTCCTGACCCCCATCCCTGCAGCT

CTCCCGCCTGTCCTCTGGGCTGGGGGGGGGCTCCCCAGGCTCCCCTAGGCAGAGCCTGGCTCTCTCAAGGAGAGTCAAGTCTTTTCTTTTGTCCTTGTGT

ACCAGTTTCCTGAGCCGCACCCAGAGTGTCCACTTGGTGACCTCTCCATGCCCAGGCTCCCCGTGGTTGTCTCCAAGCTCTGAGCTGTGGACAGGCATCT

CTGTGTGCATGAGGGGTGGGGTGTGGCAGGTGAGAGGGTGAAGCACGGGATTCTTCTCCTTGAAATGGACTGGTCCCACCTTCCATCCCAGCAGCCTCAA

AGCCCTTCTGCCCCAAGGACTGCTGGGAAGTATCTCCTGCCCTTGTTGTTAGTGGCCATGTGGAATCAGCCGGAGACTCCTCTCATGAGACACAGGGCAA

GGCTCTCCTTTTCACTGGGGAAGGAGTTCCCTCTCCCCTTCCCCAGCCTGACCCGGGACTGAACAGCCCACCACATCTTACTGGACCAGCCATTCACAGC

CCTGGCATTGGCCCGAGGATCACACAGTCTTCCTGTCCCCTTCTCCCAGCTCGGGCCACATGAACCTTTCACACCCCTTCCACCAGAACTGCTGCGTGGC

CGAGGCTGGTGCGGTGGTGTAGAGCGACTTGTCAAAGTGTTGCTGAGCTCCCGGTGAGACACCTGGGCCAGGAGTGATCTCACCGTGAGGCCCCGTTAGC

AGGGAAACCTGGCCTGCCAGGGACTTCATCAGGGACCGCATGCGATTTGTACTTCTTACCTTGCTGGCTTTTCTAGATTCTTTTTGAGTGTGGGAAGAAG

GGTTTTAGTAGAAGGGTGAATCATATTTTACACAGCGGTCTTATTTATATAAACGTCTTGGTTTTTACAATTAAAACGACC
Translation
 - UNI18033 - MGETEGKKEEADYKRLQTFPLVR HSDMPEEMRVETMELCVTACEKFSNNNE - UNI18634 - SAAKMIKETMDKKFGSSWHV

VIGEGFGFEITHEVKNLLYLYFGGTLAVCVWKCS
Transcript ENSMUST00000069877
Sequence
GACTTCCGTGATGGTTGCTAAGACACTCTGGCTCGCTCCTTGACAACCCTGGCGGGGGTGCGCTGGCTGTGGCCTCGGCTCCGGCCCCCGCGGGAGCAG 

- UNI18033 - CACCCCTTGGGGAAAGACATTTTCTGCTCCTGCCAAGTTGGCAAGGCCTGCTTCCCGAGCCCGTGGGGCGCTGTAACTGTTGGGCCC

AGCACCTCCTGAAAGCCCTACTCTCCTCCTGAGGGCACGCTGGGAGGATCATGGGAGAGACTGAAGGGAAGAAAGAGGAGGCTGACTATAAACGGCTGCA

GACCTTCCCCCTGGTCAGG CACTCGGACATGCCAGAGGAGATGCGCGTGGAGACCATGGAGCTGTGTGTCACAGCCTGTGAGAAATTCTCCAACAACAA

TGAG - UNI18634 - AGTGCTGCAAAGATGATCAAGGAGACAATGGACAAGAAGTTCGGCTCCTCCTGGCATGTGGTGATCGGCGAGGGGTTTGGGT

TTGAGATCACCCACGAG CCTCAAAGCCCTTCTGCCCCAAGGACTGCTGGGAAGTATCTCCTGCCCTTGTTGTTAGTGGCCATGTGGAATCAGCCGGAGA

CTCCTCTCATGAGACACAGGGCAAGGCTCTCCTTTTCACTGGGGAAGGAGTTCCCTCTCCCCTTCCCCAGCCTGACCCGGGACTGA
Translation
 - UNI18033 - MGETEGKKEEADYKRLQTFPLVR HSDMPEEMRVETMELCVTACEKFSNNNE - UNI18634 - SAAKMIKETMDKKFGSSWHV

VIGEGFGFEITHE PQSPSAPRTAGKYLLPLLLVAMWNQPETPLMRHRARLSFSLGKEFPLPFPSLTRD

For any suggestions or comments, please send an email to unitrap@crg.es