Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000022432 (Smc1b)
Chromosomal location
Chr 15: 84895121 - 84962387 (-)
Description
structural maintenance of chromosomes 1B Gene [Source:MGI Symbol;Acc:MGI:2154049]
RefSeq_dna
NM_080470 
RefSeq_peptide
NP_536718.1 
UniGene
Mm.182737 
MGI
MGI:2154049 
Uniprot/SWISSPROT
Q920F6 
Uniprot/SPTREMBL
A1L2Z0 
Human Ortholog
ENSG00000077935 (SMC1B)
Omim not available
UniTrap UNI20619
Vector Insertion
Chr 15: 84945317 - 84946268
Public Clones not available
Private Clones OST356770 (lexicon)
Severity of mutation (?) Insertion after 36% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI26177
Vector Insertion
Chr 15: 84928464 - 84937347
Public Clones not available
Private Clones OST132410 (lexicon)
Severity of mutation (?) Insertion after 55% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI27658
Vector Insertion
Chr 15: 84898237 - 84900074
Public Clones not available
Private Clones OST54377 (lexicon)
Severity of mutation (?) Insertion after 91% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000023068
Sequence
CTGAGGCACGGCGCGCAGCCATGGGGCACCTTGAGCTGCTGCTCGTGGAGAATTTCAAGTCGTGGCGAGGCCGCCAGGTCATCGGCCCTTTCAAGAGGTT

CACCTGCATCATTGGCCCCAACGGCTCCG GAAAATCTAATGTAATGGATGCACTTAGTTTTGTAATGGGAGAAAAGACAACTAATTTAAGAGTAAAAAA

CATTCAAGAACTTATTCATGGAGCACATACTGGAAAACCTGTTTCTTCTTCTGCAAGTGTGACAATTATATACATAGAGGACAGTGGAGAAGAGAAAACA

TTCACAAGGATTATCCGAG GGGGGTGCTCAGAATATCATTTTGGGGATAAACCCGTGAGTCGTTCTGTGTATGTAGCCCAGTTGGAAAACATAGGCATA

ATAGTCAAAGCACAGAACTGTCTAGTTTTTCAG GGAACTGTAGAGTCAATATCCATGAAAAAGCCCAAAGAGAGAACCCAGTTTTTTGAAGAAATCAGT

ACTTCAGGAGAATTTATAGGAGAATATGAGGCAAAGAAAAAGAAATTACAAAAAGCTGAAGAAGATGCACAATTTCATTTTAATGTGAAAAAAAATGTAG

CTGCAGAACGGAAGCATGCAAAAATAGAGAAAGAAGAG GCAGAACATTACCAAAATCTCCTTGAAGAATTGAAAATAAACAAGATACAACTGATGCTTT

TCCAACTATATTATAATGAGGAAAAAATCAATGTTTTAAACACTGAATTAGAGCAAATGGACGGGAATTTAAGTGTTGTAAAAGACACTCTTTCTCACCA

TGAAAACATATTTAAAGCTAAGAAAAAGGATTATGGAATGTTAACTAGACAACTACAGCAAACAGCAAAAGAACTGAA ATCTGTTGAAGCAATTTTAAA

TCAGAAGAGGCCTCAGTACATTAAGGCTAAAGAAAACACTTCTCATCATCTAAAAAAATTAGATTTGTCTAAGAAATTGATAACAGACAATGAAAAACAA

TGTTCTAAGCAGGAAGATGGCATACGAGCCTTAGTGGCAGAACTGGCTGATTTGGATAGAGCATGGAAAAGTTTTGAAAAGCAGATGGAAGAGAAAATCT

TACAAAAAGGGCGAGATATTGAATTGGAAAATAGCCAG CTGGATCGTTACAAACTGCTTAAGGAGCAAGTCAGACGGAAGGTTGGTATAATGACACAAC

AACTGGAAAAACTGCAGTGGGAACAGAAGGCAGAAAAAGAAAGACTTGCATTTGAAAAGAGGAGGCATGGAGACACTCAG GGAAATCTAAAACAGATAA

AAGAACAAATAGAAGAGCATAAAAAACGAATAGAGAAGTTGGAGGAATATACAAAGACGTGCAT - UNI20619 - GGATTGCTTGGAAGATAAAAAA

CAGCAAGAAGAGGCCCTGAAAAAAGAAATTGAAAATACGAAATCAAGAATGTCTGAAGTTAATGAAGAATTGAGTCTTATTAGAAATGAATTGCAGAATG

CTGGAATTGATAACCATGAGGGAAAACGTCAGCAGAAAAGAGCAGAAGTTCTGGAACACCTTAAAAGACTTTACCCAGATTCTGTG TTTGGAAGACTGC

TTGATCTGTGTCATCCTATTCATAAGAAGTACCAGCTGGCTGTGACTAAGCTTTTTGGCCGGTACATGGTTGCCATTGTTGTAGCCTCAGAAAAGATAGC

GAAAGATTGTATTCGATTTCTGAAGGCAGAAAGAGCTGAACCTGAGACATTCCTTGCTCTAGATTACCTTGAT ATCAAGCCAATCAATGAACGACTAAG

GGAAATTAAAGGCTGTAAGATGATGATCGATGTTATAAAGACCCAGTTTCCTCAGCTGAAGAAAGTGATTCAGTTTGTTTGTGGAAATGGCCTTGTCTGT

GAGACTGTGGAAGAAGCAAGACATATTGCATTCGGTGGACCTGAAAGACGGAAG GCAGTAGCACTTGATGGAACACTGTTTTTGAAATCTGGAGTGATT

TCTGGAGGGTCAAGTGACTTAAAGCACAAAGCTCTGTGCTGGGATGAGAAAGAGTTACACAATCTAAGAGACAAAAGAAGCCAACTAGTCCAAGAGCTAA

AG - UNI26177 - GAGTTAATGAAGACACTCCGCAAGGAAACAGATCTGAAGCAAATACAGACTTTAGTACAAGGAACCAATACACGACTCAAATAT

TCACAAAATGAACTAGAGATGATTAAAAAGAAGCACCTTGCTACATTTTACCGG GAACAATCTCAGCTACAAAGTGAATTACTGAATATTGATTCTCAA

TGTACTATGTTGAGTGAAGGAATCAACAAACAGCAACAAAAAATTGAAGAATTTCAAGATAAGATAGATGAG GTAGAAGATGACATATTCCAAGACTTC

TGTGAAGAAATTGGTGTGGAAAATATCCGTGAATTTGAGAATAAACATGTTAAACAGCAGCAAGAAAATGATCAAAAAAG ATTAGAGTTTGAAAAACAA

AAAACTCGGCTTAATATTCAGCTCGAATATAGTCGAAATCAGCTTAAGAAGAAACTGAATAATATCGACACATTAAAAACCACAATCCAGAAGGGCAAAG

AAGATATTGATAACCTAAAAAAG ACCGAAGAAGAATGTCTGAAAATTGTTGAGGAACTCATGGTGAAGCAAGAGCAAATTAAGGAAGTGCTTGCCACAC

AGAGTTCCAACATTGAAAAAATTCACATACAAATTGAAGAGGAACGCAAGAAGGTTTTGGCTGTTGATAG GGAAGTTGGAAAATTACAGAAGGAAGTTG

TAATCATTCAGGGTTCTTTGGAACAGAAACTGCTAGAGAAACATAACTTGCTGCTAGATTGCAAAGTTCAAGACATTGACATAAGTCTTGTGCTGGGGTC

ATTGGAGGACATCATTGAAATGGAG CTAACTGAAACAGAAAGCACCCAGGCAACAGCTGATATCTATGAGAAAGAAGCATCCATCCAAATAGACTACAG

CCCTCTAAGGGAGGATTTAAAG GCTCTACAATCAGATAAGGAGGTGGAGGCCCACCTTACACTCCTTCTACAGCAAGTAGCATCCCAAGAAAACACTCT

ACTGAAGACTACAGCTCCAAACTTGCGAGCACAGGAGAACTTAAAGACTGTCAGAGACAAGTTTCAAGAATCTGCAGATG TTTTTGAGGCCAGCAGAAA

GGAAGCCAGAATATGTAGGCAAGAGTTTGAACAGGTGAAAAGACGGAGGTACGATGCTTTCAGTCAATGTTTTGAACACATCTCAGTCTCAATTGATCAA

ATCTACAAGAAGCTCTGCAGGAACAACAGTGCCCAG GCATTTCTTAGCCCAGAGAACCCTGAAGAACCTTACTTAGATGGAATTAGCTACAACTGTGTG

GCTCCAGGCAAACGGTTCATGCCCATGGACAACCTGTCAGGGGGAGAAAAGTGTGTGGCTGCTCTGGCTCTTCTGTTTGCTGTACACAG - UNI27658

 - TTTTCGGCCTGCTCCATTCTTTGTATTAGATGAAGTAGATGCAGCCCTGGACAATACTAACATTGGCAAA GTCTCAAGTTACATCAAAGAGCAGAG

TCAGGAACAGTTTCAGATGATAATCATTTCCCTGAAAGAGGAGTTCTACTCCAAAGCTGATGCACTGATAGGCGTCTACCCAGAG CACAATGAGTGCAT

GTTCAGCCATGTGTTGACTCTGGACCTTTCCAAGTATCCAGACACCGAAGACCAAGAAGGCAGCAGGAGCCACCGGAAGCCCAGAGTACCACGAGTATCA

ATGTCTCCAAAGTCTCCCCAGTCTCGTTAGAAATGAGTATACTCTTGAACAGCCACCAGCTATAGAAGCTTTACCCTGACCCTGTGGAGGTCAGGCCAGT

CTCTGTTTAGACCCATGTGTCATAGAAGAAAAATCTCTTACCATTTTAGTAGAAAAAAAACTATAGCCCACTCAGCTAAGGAGTGCTCAGTGTCATTCCA

ATGGAGGTTCCTATGGCATCAATGAATGAGGTATATGGTTTTCTTTTGCTTTTAAGGGCTTTTGTTTTGAAACAAATTGGTTATAAAATTTTGAATTCTG

C
Translation
MGHLELLLVENFKSWRGRQVIGPFKRFTCIIGPNGSG GKSNVMDALSFVMGEKTTNLRVKNIQELIHGAHTGKPVSSSASVTIIYIEDSGEEKTFTRII

RG GGCSEYHFGDKPVSRSVYVAQLENIGIIVKAQNCLVFQ GTVESISMKKPKERTQFFEEISTSGEFIGEYEAKKKKLQKAEEDAQFHFNVKKNVAAE

RKHAKIEKEE AEHYQNLLEELKINKIQLMLFQLYYNEEKINVLNTELEQMDGNLSVVKDTLSHHENIFKAKKKDYGMLTRQLQQTAKELK KSVEAILN

QKRPQYIKAKENTSHHLKKLDLSKKLITDNEKQCSKQEDGIRALVAELADLDRAWKSFEKQMEEKILQKGRDIELENSQ LDRYKLLKEQVRRKVGIMTQ

QLEKLQWEQKAEKERLAFEKRRHGDTQ GNLKQIKEQIEEHKKRIEKLEEYTKTCM - UNI20619 - MDCLEDKKQQEEALKKEIENTKSRMSEVNE

ELSLIRNELQNAGIDNHEGKRQQKRAEVLEHLKRLYPDSV FGRLLDLCHPIHKKYQLAVTKLFGRYMVAIVVASEKIAKDCIRFLKAERAEPETFLALD

YLD IKPINERLREIKGCKMMIDVIKTQFPQLKKVIQFVCGNGLVCETVEEARHIAFGGPERRK AVALDGTLFLKSGVISGGSSDLKHKALCWDEKELH

NLRDKRSQLVQELK - UNI26177 - ELMKTLRKETDLKQIQTLVQGTNTRLKYSQNELEMIKKKHLATFYR EQSQLQSELLNIDSQCTMLSEGINK

QQQKIEEFQDKIDE VEDDIFQDFCEEIGVENIREFENKHVKQQQENDQKR RLEFEKQKTRLNIQLEYSRNQLKKKLNNIDTLKTTIQKGKEDIDNLKK

 TEEECLKIVEELMVKQEQIKEVLATQSSNIEKIHIQIEEERKKVLAVDR REVGKLQKEVVIIQGSLEQKLLEKHNLLLDCKVQDIDISLVLGSLEDII

EME LTETESTQATADIYEKEASIQIDYSPLREDLK ALQSDKEVEAHLTLLLQQVASQENTLLKTTAPNLRAQENLKTVRDKFQESADV VFEASRKEA

RICRQEFEQVKRRRYDAFSQCFEHISVSIDQIYKKLCRNNSAQ AFLSPENPEEPYLDGISYNCVAPGKRFMPMDNLSGGEKCVAALALLFAVHS - UN

I27658 - SFRPAPFFVLDEVDAALDNTNIGK VSSYIKEQSQEQFQMIIISLKEEFYSKADALIGVYPE HNECMFSHVLTLDLSKYPDTEDQEGSRS

HRKPRVPRVSMSPKSPQSR

For any suggestions or comments, please send an email to unitrap@crg.es