Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000022442 (Ttll1)
Chromosomal location
Chr 15: 83314202 - 83341323 (-)
Description
tubulin tyrosine ligase-like 1 Gene [Source:MGI (curated);Acc:Ttll1-001]
RefSeq_dna
NM_178869 
RefSeq_peptide
NP_849200.2 
UniGene
Mm.235007 Mm.406235 Mm.423624 Mm.427774 
MGI
MGI:2443047 
Uniprot/SWISSPROT
Q91V51 
Uniprot/SPTREMBL
A6PW19 A6PW21 Q8BJG7 
Human Ortholog
ENSG00000100271 (TTLL1)
Omim not available
UniTrap UNI20104
Vector Insertion
Chr 15: 83320063 - 83322303
Public Clones not available
Private Clones OST372941 (lexicon)
Severity of mutation (?) Insertion after 77% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000109480
Sequence
GCCCGTGAAGGATCCGGGCGGTTTAGCTTCTGCTACCCAGTCCGTGTCTCCGCTGCTCAACGTCGTTTTCTCTGTTGATATCCTGGGACTTGCCTTGTGC

CTTCAACTGCTGTAATTGCATCATTATCTTTCTTACCGGCTATTCTAG TGACGCCAAGAGACTCTGAGCGCTCCAGGAGCTGCGGAAGGACCTATG CC

CTCGTGCCTCTTCTGTGGTTCCTGATACAGGCGCCACTGGATGCTC GATCATGGCGGGAAGGGTGAAGTGGGTCACTGACATTGAGAAGTCGGTACTAA

TCAACAACTTCGAGAAGAGAGGGTGGATCCAAGTGACAGAAAATGAAGACTGGAATTTTTACTG GATGAGCGTGCAAACCATTCGCAACGTGTTCAGCG

TAGAAACTGGGTACCGGCTGTCAGACGACCAGATCGTCAACCATTTCCCCAACCACTACGAGCTGACCCGCAAGGACCTGATGGTGAAGAACATTAAGAG

ATACAGGAAGGAGCTGGAGAAGGAAGGAAGTCCCTTGGCGGAGAAAGACGAGAATGGAAAATACCTCTATCTGG ACTTTGTCCCCGTCACCTACATGCT

CCCCGCCGACTACAACCTGTTTGTGGAAGAGTTCCGGAAGAGCCCGTCCAGCACCTGGATCATGAAGCCATGTGGCAAAGCACAGGGAAAAGGCATCTTC

CTCATCAATAAGCTTTCGCAGATCAAAAAGTGGTCCCGGGACAGCAAGACGTCCTC GTTTGTGTCGCAGTCCACAAAAGAAGCGTACGTGATCTCAGTC

TATATCAATAATCCGTTGCTCATCGGTGGAAGGAAGTTTGACCTTCGTCTGTATGTCCTGGTGTCCACGTACCGCCCGCTGCGCTGCTACAT GTACAAG

CTTGGGTTCTGCCGCTTCTGCACAGTGAAGTACACCCCTAGTACCAGTGAGCTCGACAACATGTTTGTCCACCTTACCAACGTGGCCATCCAGAAGCATG

GG GAGGACTACAACCACATCCACGGTGGCAAGTGGACTGTCAACAACCTGCGTCTCTACCTGGAGAGCACCCGAGGCCGAGAGGTGACCAGCAAGCTGT

TTGATGAAATCCACTGGATCATCGTGCAGTCTCTCAAGGCCGTGGCG CCAGTGATGAACAACGACAAACACTGCTTTGAATGCTACGGCTACGACATCA

TCATCGATGACAAGCTGAAGCCCTGGCTGATCGAG - UNI20104 - GTCAACGCGTCCCCGTCTCTCACATCCAGCACCGCCAACGATCGAATCCTT

AAGTACAACCTGATTAACGACACCCTCAACATTGCGGTCCCCAACGGCGAGATTCCCGACTGCAAGTGGAACAAGTCTCCCCCCAAGGAAGTACTTGGCA

ACTATGAGATCCT GTATGACGAGGAGCTGGCCCAGGGTGACGGGGCTGAACGAGAGCTTAGAAACCGCCCAGGCCAGCCAGTGGGGCCCAGAGCAGGCC

GCTCGAGAGACTCAGGAAGAAGTGTCCTCACAACCTGGAAGTGACCAGCAGCGAGAAGAAGGACCCCAGCTTGGACCTTCCCACAGTCGCTCCACCCAGT

CCCTGCTAAACACCCGTTTTGGAATTTCAGTTTTCCAGAGTGCTTTCCTGAGCAGGCCTTGTAAATAAAGACTCAATGCAAGGTGGAGGAGTCCACATCA

CTGGGGCTCAAGCACTTGCAAGTGCACACATGCACACACACACACACACACGCACGCACGCACGCACGCACACATGCACACACAAAAACAACAGCTTCGG

TATGTGATGGAACTTCCTTTTTTAAAGATTTATTATTTTTGAGATAGGTACCTCTGGATGGCCTGGAACTTGCCATGTAGACCAGGCTGGCCTAGAACTC

Translation
   MAGRVKWVTDIEKSVLINNFEKRGWIQVTENEDWNFYW WMSVQTIRNVFSVETGYRLSDDQIVNHFPNHYELTRKDLMVKNIKRYRKELEKEGSPL

AEKDENGKYLYLD DFVPVTYMLPADYNLFVEEFRKSPSSTWIMKPCGKAQGKGIFLINKLSQIKKWSRDSKTSS SFVSQSTKEAYVISVYINNPLLIG

GRKFDLRLYVLVSTYRPLRCYM MYKLGFCRFCTVKYTPSTSELDNMFVHLTNVAIQKHG EDYNHIHGGKWTVNNLRLYLESTRGREVTSKLFDEIHWI

IVQSLKAVA PVMNNDKHCFECYGYDIIIDDKLKPWLIE - UNI20104 - VNASPSLTSSTANDRILKYNLINDTLNIAVPNGEIPDCKWNKSPPKE

VLGNYEIL LYDEELAQGDGAERELRNRPGQPVGPRAGRSRDSGRSVLTTWK
Transcript ENSMUST00000109479
Sequence
AAGGATCCGGGCGGTTTAGCTTCTGCTACCCAGTCCGTGTCTCCGCTGCTCAACGTCGTTTTCTCTGTTGATATCCTGGGACTTGCCTTGTGCCTTCAAC

TGCTGTAATTGCATCATTATCTTTCTTACCGGCTATTCTAG TGACGCCAAGAGACTCTGAGCGCTCCAGGAGCTGCGGAAGGACCTATG GGACTGGGC

ATTTATGGAATGCTGGAGGCCTGTCTGCACGTGGAGTGTTGACCAGTGTCCCTGATCCTCCGCCATACTAGATGCCTGAAGTGTCTCTTCTTTCCCCATA

CATGGTGACCTCCTGACGTCTCTAGACATTACCAGCAATTGTGGGGTAGAGG GATCATGGCGGGAAGGGTGAAGTGGGTCACTGACATTGAGAAGTCGG

TACTAATCAACAACTTCGAGAAGAGAGGGTGGATCCAAGTGACAGAAAATGAAGACTGGAATTTTTACTG GATGAGCGTGCAAACCATTCGCAACGTGT

TCAGCGTAGAAACTGGGTACCGGCTGTCAGACGACCAGATCGTCAACCATTTCCCCAACCACTACGAGCTGACCCGCAAGGACCTGATGGTGAAGAACAT

TAAGAGATACAGGAAGGAGCTGGAGAAGGAAGGAAGTCCCTTGGCGGAGAAAGACGAGAATGGAAAATACCTCTATCTGG ACTTTGTCCCCGTCACCTA

CATGCTCCCCGCCGACTACAACCTGTTTGTGGAAGAGTTCCGGAAGAGCCCGTCCAGCACCTGGATCATGAAGCCATGTGGCAAAGCACAGGGAAAAGGC

ATCTTCCTCATCAATAAGCTTTCGCAGATCAAAAAGTGGTCCCGGGACAGCAAGACGTCCTC GTTTGTGTCGCAGTCCACAAAAGAAGCGTACGTGATC

TCAGTCTATATCAATAATCCGTTGCTCATCGGTGGAAGGAAGTTTGACCTTCGTCTGTATGTCCTGGTGTCCACGTACCGCCCGCTGCGCTGCTACAT G

TACAAGCTTGGGTTCTGCCGCTTCTGCACAGTGAAGTACACCCCTAGTACCAGTGAGCTCGACAACATGTTTGTCCACCTTACCAACGTGGCCATCCAGA

AGCATGGG GAGGACTACAACCACATCCACGGTGGCAAGTGGACTGTCAACAACCTGCGTCTCTACCTGGAGAGCACCCGAGGCCGAGAGGTGACCAGCA

AGCTGTTTGATGAAATCCACTGGATCATCGTGCAGTCTCTCAAGGCCGTGGCG TGATGAACAACGACAAACACTGCTTTGAATGCTACGGCTACGACAT

CATCATCGATGACAAGCTGAAGCCCTGGCTGATCGAGGTAACGCACAGCCCTGACACCTTGGCCAGCAGTGCCACAGGAAAAGAGGACATTCTCATTGCT

CTCCCGCATGTGTTAAGGCATGATTTGGAAGTGAGTCCGTCTGCCCTTTGAAGCAGAGAGGGTGTAGTGGTGGCTGACCTAGAAATGAGAAGATATACAC

CATACAGCAGGGCTTTTCCCTGGCCGCAGCCACAGCGTCATTTCTCAGAACTGATCAAATACCTGACCTTCCCCAAAACAAAACAAACAAACAAACAAAC

AAACAAAAACAACTCCAGGGAGGAAGGCTTTATTTGGTTTGAGGCTACAATTCTTCATGGTGGGGAAAGCCTTGGGTATGGGTGAGGCAGCTGAGCACAT

CTGTCAGAGCTGAAGCCGAGCAAGGCGGATACTGATCCTCAACAGGCTTCTTTCTTCCTTCAGCTCAGTGCCCCAGCCTGTGGGATGATGTCACTCACGA

TCAGGGTGTGTCTTCCCTCCTAAGTTAGACTTCTCTGGAAACACTCCCAGAGTTACCCTGAGATACCGCTGGACTGTCTCCGATCCCACTAGCAGTTTAA

ATAATGACACAACTACTCCTAATGTAGTTTAAAGATTAGGCCTTTTGTGGGGGAGGGTGTGGGAGACTTTTGGGATAGCATTGGAAATGTAATTGAGGAA

AATACG
Translation
   MAGRVKWVTDIEKSVLINNFEKRGWIQVTENEDWNFYW WMSVQTIRNVFSVETGYRLSDDQIVNHFPNHYELTRKDLMVKNIKRYRKELEKEGSPL

AEKDENGKYLYLD DFVPVTYMLPADYNLFVEEFRKSPSSTWIMKPCGKAQGKGIFLINKLSQIKKWSRDSKTSS SFVSQSTKEAYVISVYINNPLLIG

GRKFDLRLYVLVSTYRPLRCYM MYKLGFCRFCTVKYTPSTSELDNMFVHLTNVAIQKHG EDYNHIHGGKWTVNNLRLYLESTRGREVTSKLFDEIHWI

IVQSLKAVA A
Transcript ENSMUST00000016897
Sequence
GCAGGCGGGCTTGCCCGTGAAGGATCCGGGCGGTTTAGCTTCTGCTACCCAGTCCGTGTCTCCGCTGCTCAACGTCGTTTTCTCTGTTGATATCCTGGGA

CTTGCCTTGTGCCTTCAACTGCTGTAATTGCATCATTATCTTTCTTACCGGCTATTCTAG TGACGCCAAGAGACTCTGAGCGCTCCAGGAGCTGCGGAA

GGACCTATG GGACTGGGCATTTATGGAATGCTGGAGGCCTGTCTGCACGTGGAGTGTTGACCAGTGTCCCTGATCCTCCGCCATACTAGATGCCTGAAG

TGTCTCTTCTTTCCCCATACATGGTGACCTCCTGACGTCTCTAGACATTACCAGCAATTGTGGGGTAGAGG GATCATGGCGGGAAGGGTGAAGTGGGTC

ACTGACATTGAGAAGTCGGTACTAATCAACAACTTCGAGAAGAGAGGGTGGATCCAAGTGACAGAAAATGAAGACTGGAATTTTTACTG GATGAGCGTG

CAAACCATTCGCAACGTGTTCAGCGTAGAAACTGGGTACCGGCTGTCAGACGACCAGATCGTCAACCATTTCCCCAACCACTACGAGCTGACCCGCAAGG

ACCTGATGGTGAAGAACATTAAGAGATACAGGAAGGAGCTGGAGAAGGAAGGAAGTCCCTTGGCGGAGAAAGACGAGAATGGAAAATACCTCTATCTGG 

ACTTTGTCCCCGTCACCTACATGCTCCCCGCCGACTACAACCTGTTTGTGGAAGAGTTCCGGAAGAGCCCGTCCAGCACCTGGATCATGAAGCCATGTGG

CAAAGCACAGGGAAAAGGCATCTTCCTCATCAATAAGCTTTCGCAGATCAAAAAGTGGTCCCGGGACAGCAAGACGTCCTC GTTTGTGTCGCAGTCCAC

AAAAGAAGCGTACGTGATCTCAGTCTATATCAATAATCCGTTGCTCATCGGTGGAAGGAAGTTTGACCTTCGTCTGTATGTCCTGGTGTCCACGTACCGC

CCGCTGCGCTGCTACAT GTACAAGCTTGGGTTCTGCCGCTTCTGCACAGTGAAGTACACCCCTAGTACCAGTGAGCTCGACAACATGTTTGTCCACCTT

ACCAACGTGGCCATCCAGAAGCATGGG GAGGACTACAACCACATCCACGGTGGCAAGTGGACTGTCAACAACCTGCGTCTCTACCTGGAGAGCACCCGA

GGCCGAGAGGTGACCAGCAAGCTGTTTGATGAAATCCACTGGATCATCGTGCAGTCTCTCAAGGCCGTGGCG CCAGTGATGAACAACGACAAACACTGC

TTTGAATGCTACGGCTACGACATCATCATCGATGACAAGCTGAAGCCCTGGCTGATCGAG - UNI20104 - GTCAACGCGTCCCCGTCTCTCACATC

CAGCACCGCCAACGATCGAATCCTTAAGTACAACCTGATTAACGACACCCTCAACATTGCGGTCCCCAACGGCGAGATTCCCGACTGCAAGTGGAACAAG

TCTCCCCCCAAGGAAGTACTTGGCAACTATGAGATCCT GTATGACGAGGAGCTGGCCCAGGGTGACGGGGCTGAACGAGAGCTTAGAAACCGCCCAGGC

CAGCCAGTGGGGCCCAGAGCAGGCCGCTCGAGAGACTCAGGAAGAAGTGTCCTCACAACCTGGAAGTGACCAGCAGCGAGAAGAAGGACCCCAGCTTGGA

CCTTCCCACAGTCGCTCCACCCAGTCCCTGCTAAACACCCGTTTTGGAATTTCAGTTTTCCAGAGTGCTTTCCTGAGCAGGCCTTGTAAATAAAGACTCA

ATGCAAGGTGGAGGAGTCCACATCACTGGGGCTCAAGCACTTGCAAGTGCACACATGCACACACACACACACACACGCACGCACGCACGCACGCACACAT

GCACACACAAAAACAACAGCTTCGGTATGTGATGGAACTTCCTTTTTTAAAGATTTATTATTTTTGAGATAGGTACCTCTGGATGGCCTGGAACTTGCCA

TGTAGACCAGGCTGGCCTAGAACTCACAGAGATCTACCTGCCTCTGCCTCCCAAGTGCTGGGATTAAAGGTGTGTGCCACC
Translation
   MAGRVKWVTDIEKSVLINNFEKRGWIQVTENEDWNFYW WMSVQTIRNVFSVETGYRLSDDQIVNHFPNHYELTRKDLMVKNIKRYRKELEKEGSPL

AEKDENGKYLYLD DFVPVTYMLPADYNLFVEEFRKSPSSTWIMKPCGKAQGKGIFLINKLSQIKKWSRDSKTSS SFVSQSTKEAYVISVYINNPLLIG

GRKFDLRLYVLVSTYRPLRCYM MYKLGFCRFCTVKYTPSTSELDNMFVHLTNVAIQKHG EDYNHIHGGKWTVNNLRLYLESTRGREVTSKLFDEIHWI

IVQSLKAVA PVMNNDKHCFECYGYDIIIDDKLKPWLIE - UNI20104 - VNASPSLTSSTANDRILKYNLINDTLNIAVPNGEIPDCKWNKSPPKE

VLGNYEIL LYDEELAQGDGAERELRNRPGQPVGPRAGRSRDSGRSVLTTWK
Transcript ENSMUST00000109481
Sequence
GCAGGCGGGCTTGCCCGTGAAGGATCCGGGCGGTTTAGCTTCTGCTACCCAGTCCGTGTCTCCGCTGCTCAACGTCGTTTTCTCTGTTGATATCCTGGGA

CTTGCCTTGTGCCTTCAACTGCTGTAATTGCATCATTATCTTTCTTACCGGCTATTCTAG TGACGCCAAGAGACTCTGAGCGCTCCAGGAGCTGCGGAA

GGACCTATG GGACTGGGCATTTATGGAATGCTGGAGGCCTGTCTGCACGTGGAGTGTTGACCAGTGTCCCTGATCCTCCGCCATACTAGATGCCTGAAG

TGTCTCTTCTTTCCCCATACATGGTGACCTCCTGACGTCTCTAGACATTACCAGCAATTGTGGGGTAGAGG GATCATGGCGGGAAGGGTGAAGTGGGTC

ACTGACATTGAGAAGTCGGTACTAATCAACAACTTCGAGAAGAGAGGGTGGATCCAAGTGACAGAAAATGAAGACTGGAATTTTTACTG GATGAGCGTG

CAAACCATTCGCAACGTGTTCAGCGTAGAAACTGGGTACCGGCTGTCAGACGACCAGATCGTCAACCATTTCCCCAACCACTACGAGCTGACCCGCAAGG

ACCTGATGGTGAAGAACATTAAGAGATACAGGAAGGAGCTGGAGAAGGAAGGAAGTCCCTTGGCGGAGAAAGACGAGAATGGAAAATACCTCTATCTGG 

ACTTTGTCCCCGTCACCTACATGCTCCCCGCCGACTACAACCTGTTTGTGGAAGAGTTCCGGAAGAGCCCGTCCAGCACCTGGATCATGAAGCCATGTGG

CAAAGCACAGGGAAAAGGCATCTTCCTCATCAATAAGCTTTCGCAGATCAAAAAGTGGTCCCGGGACAGCAAGACGTCCTC GTTTGTGTCGCAGTCCAC

AAAAGAAGCGTACGTGATCTCAGTCTATATCAATAATCCGTTGCTCATCGGTGGAAGGAAGTTTGACCTTCGTCTGTATGTCCTGGTGTCCACGTACCGC

CCGCTGCGCTGCTACAT GTACAAGCTTGGGTTCTGCCGCTTCTGCACAGTGAAGTACACCCCTAGTACCAGTGAGCTCGACAACATGTTTGTCCACCTT

ACCAACGTGGCCATCCAGAAGCATGGG GAGGACTACAACCACATCCACGGTGGCAAGTGGACTGTCAACAACCTGCGTCTCTACCTGGAGAGCACCCGA

GGCCGAGAGGTGACCAGCAAGCTGTTTGATGAAATCCACTGGATCATCGTGCAGTCTCTCAAGGCCGTGGCG - UNI20104 - GTCAACGCGTCCCC

GTCTCTCACATCCAGCACCGCCAACGATCGAATCCTTAAGTACAACCTGATTAACGACACCCTCAACATTGCGGTCCCCAACGGCGAGATTCCCGACTGC

AAGTGGAACAAGTCTCCCCCCAAGGAAGTACTTGGCAACTATGAGATCCT GTATGACGAGGAGCTGGCCCAGGGTGACGGGGCTGAACGAGAGCTTAGA

AACCGCCCAGGCCAGCCAGTGGGGCCCAGAGCAGGCCGCTCGAGAGACTCAGGAAGAAGTGTCCTCACAACCTGGAAGTGACCAGCAGCGAGAAGAAGGA

CCCCAGCTTGGACCTTCCCACAGTCGCTCCACCCAGTCCCTGCTAAACACCCGTTTTGGAATTTCAGTTTTCCAGAGTGCTTTCCTGAGCAGGCCTTGTA

AATAAAGACTCAATGCAAGGTGGAGGAGTCCACATCACTGGGGCTCAAGCACTTGCAAGTGCACACATGCACACACACACACACACACGCACGCACGCAC

GCACGCACACATGCACACACAAAAACAACAGCTTCGGTATGTGATGGAACTTCCTTTTTTAAAGATTTATTATTTTTGAGATAGGTACCTCTGGATGGCC

TGGAACTTGCCATGTAGACCAGGCTGGCCTAGAACTCACAGAGATCTACCTGCCTCTGCCTCCCAAGTGCTGGGATTAAAGGTGTGTGCCACC
Translation
   MAGRVKWVTDIEKSVLINNFEKRGWIQVTENEDWNFYW WMSVQTIRNVFSVETGYRLSDDQIVNHFPNHYELTRKDLMVKNIKRYRKELEKEGSPL

AEKDENGKYLYLD DFVPVTYMLPADYNLFVEEFRKSPSSTWIMKPCGKAQGKGIFLINKLSQIKKWSRDSKTSS SFVSQSTKEAYVISVYINNPLLIG

GRKFDLRLYVLVSTYRPLRCYM MYKLGFCRFCTVKYTPSTSELDNMFVHLTNVAIQKHG EDYNHIHGGKWTVNNLRLYLESTRGREVTSKLFDEIHWI

IVQSLKAVA - UNI20104 - VNASPSLTSSTANDRILKYNLINDTLNIAVPNGEIPDCKWNKSPPKEVLGNYEIL LYDEELAQGDGAERELRNRPG

QPVGPRAGRSRDSGRSVLTTWK

For any suggestions or comments, please send an email to unitrap@crg.es