Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000022463 (Srebf2)
Chromosomal location
Chr 15: 81977696 - 82035806 (+)
Description
sterol regulatory element binding factor 2 Gene [Source:MGI Symbol;Acc:MGI:107585]
RefSeq_dna
NM_033218 
RefSeq_peptide
NP_150087.1 
UniGene
Mm.38016 Mm.457595 
MGI
MGI:107585 
Uniprot/SWISSPROT
Q3U1N2 
Uniprot/SPTREMBL
Q8BPL7 
Human Ortholog
ENSG00000198911 (SREBF2)
Omim not available
UniTrap UNI5488
Vector Insertion
Chr 15: 81977921 - 82000167
Public Clones (sanger) CSI829 (baygenomics) XD155 (baygenomics) YTA054 (baygenomics)
A065D01 (ggtc) 3SE287D10 (ggtc) E123B08 (ggtc) IST15056B7 (tigm) IST14861A2 (tigm)
IST11604C12 (tigm) IST14944A7 (tigm) IST11621A6 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 3% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI8361
Vector Insertion
Chr 15: 82000167 - 82000585
Public Clones XG031 (baygenomics)
Private Clones OST432478 (lexicon) OST406661 (lexicon) OST77128 (lexicon) OST39896 (lexicon)
Severity of mutation (?) Insertion after 3% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI813
Vector Insertion
Chr 15: 82000249 - 82000368
Public Clones CH0142 (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 3% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI8521
Vector Insertion
Chr 15: 82003330 - 82005526
Public Clones RRO076 (baygenomics) IST11947G12 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 25% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI2435
Vector Insertion
Chr 15: 82005749 - 82007585
Public Clones AC0260 (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 31% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI7417
Vector Insertion
Chr 15: 82009978 - 82012410
Public Clones RRS740 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 51% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI6220
Vector Insertion
Chr 15: 82025455 - 82026589
Public Clones CSG338 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 76% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI4849
Vector Insertion
Chr 15: 82028217 - 82030064
Public Clones AH0169 (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 85% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000023100
Sequence
AAACATGGCGGCGGTTGGCACGGGGCGGTGAGGCGGTACCAGGTGGGGGCTGTCGGGTGTCATGGGCGGTGGCGGCGGTACCGCCTCCGCGTCTCCCTGA

GCTGGACCTCACGGGGGACTCTGCGCCAAGCTGGGCGATGGATGAGAGCAGCGAGCTGGGCGTTCTGGAGACCATGGAGACCCTCACGGAGCTGGGCGAT

GAGCTGACTCTCGGGGACATCGACG - UNI5488 - - UNI8361 - AGATGCTACAGTTTGTCAGCAATCAAGTGGGAGAGTTCCCTGATTTGTTT

TCAGAGCAACTTTGTAGCTCCTTCCCTGGAGGTGGCAGCAATGGTGGCAGTGGCAACAACAGCAGTGGCAGAGGCAACAATGGTGGAGCCACAGACCCTG

CAGTACAGCGGTCATTCAGCCAGGTCCCATTATCTACCTTCTCTCCCTCAGCTGCCTCCCCTCAGGCTCCGGCCCTGCAGGTCAAAGTCTCTCCTACCCC

ACCAAGGGCAACCCCTGTTCTCCAGCCGCGACCCCAGCCCCAGCCCCAACCTCCAGCTCAGCTGCAGCAGCAGACGGTGATGATCACCCCGACGTTCAGC

ACCGCTCCGCAGACGAGGATCATCCAGCAGCCTTTGATATACCAGAACGCAGCGACCAGCTTTCAAG - UNI8361 - TCCTGCAGCCTCAAGTGCAA

AGCCTCGTGACGTCCCCGCAGGTGCAGCCCGTCACCATCCAGCAGCAGGTGCAGACGGTACAGGCCCAGCGGGTGTTGACGCAGACAGCCAATGGCACAC

TGCAGACCCTTGCCCCCGCCACGGTACAGACGGTCGCTGCGCCACAGGTGCAGCAGGTCCCG GTCCTGGTGCAACCTCAGATCATTAAGACAGATTCCC

TTGTGTTGACCACGCTGAAGACAGATGGCAGCCCTGTCATGGCTGCAGTCCAGAACCCGGCCCTCACGGCCCTCACTGCCCCCATCCAGACAGCCGCCCT

TCAAGTGCCA - UNI8521 - ACCCTGGTGGGCAGCAACGGGACCATTCTGACCACAATGCCTGTGATGATGGGGCAAGAGAAAGTTCCTATCAAGCA

AGTGCCTGGCGGCGTGAAGCAGCTGGATCCTCCCAAAGAAGGAGAGAGGCGGACAACACACAATATCATTGAAAAGCGCTACCGGTCCTCCATCAACGAC

AAAATCATAGAGTTGAAGGACTTAGTCATGGGGACAGATGCCAAG - UNI2435 - ATGCACAAGTCTGGCGTTCTGAGGAAGGCCATTGATTACATC

AAATATCTGCAGCAGGTCAATCACAAGCTGCGCCAGGAGAACATGGTGCTGAAGCTGGCCAATCAGAAAAACA AGCTCCTGAAGGGCATCGACCTGGGC

AGTCTGGTGGACAGTGATGTGGACTTGAAAATTGATGACTTTAACCAGAATGTCCTTCTGATGTCTCCGCCGGCCTCCGACTCCGGGTCCCAGGCCGGCT

TCTCTCCCTATTCCATTGACTCTGAGCCGGGCAGCCCTCTGCTGGATGACGCAAAG GTCAAGGATGAACCGGACTCTCCTCCTGTGGCACTGGGCATGG

TGGACCGCTCTCGAATCCTCTTATGTGTCCTCACCTTCCTGGGCCTCTCCTTTAACCCCTTGACTTCCTTGCTGCAGTGGGGAGGGGCCCACAACACTGA

CCAGCACCCATACTCAGGCTCGGGCCGCAGTGTACTGTCACTGGAGTCAG GTGCTGGGGGCTGGTTTGACTGGATGGTTCCAACTCTCCTCCTGTGGCT

GGTAAATGGTGTGATTGTCTTGAGCGTCTTTGTGAAGCTGTTGGTCCACGGGGAGCCGGTGATTCGCCCACACTCACGCCCCTCAGTCACCTTCTGGAGA

CACCGGAAGCAGGCAGACCTAGACCTCGCCAAA - UNI7417 - GGTGATTTCGCAGCTGCTGCTGCCAACCTACAAACCTGCTTATCCGTGCTGGGC

CGGGCGCTGCCCACCTCCCGCCTGGACTTGGCCTGCAGCCTCTCCTGGAATGTGATCCGCTACAGCCTGCAGAAGCTGCGCCTGGTACGCTGGTTACTCA

AGAAGGTCTTCCAGCGCTGGCGGGCTACTCCCGCCACTGCAGCTGGCTTTGAGGATGAGGCTAAGAGCAGCGCAAGGGATGCGGCACTGGCCTACCACAG

GCTGCACCAGCTGCACATCACAG GGAAGCTTCCGGCGGGATCTGCCTGTTCAGATGTGCACATGGCTCTGTGTGCTGTGAACCTGGCCGAGTGTGCGGA

GGAGAAAATCCTACCAAGCACACTGATTGAGATCCACCTGACAGCGGCCATGGGGCTCAAGACCCGCTGTGGAGGCAAGCTGGGCTTCTTGGCT AGCTA

CTTCTTAAATCGTGCCCAGAGTCTGTGTGGCCCAGAGCATAGCACTGTCCCCGACTCCCTGCGCTGGCTATGCCATCCCTTGGGCCAGAAGTTTTTCATG

GAGCGAAGCTGGTCGATCAAGTCAGCAGCCAAGGAGAGCCTGTACTGCGCCCAGAGGAGCCCAG CTGACCCCATTGCCCAGGTACACCAGGCGTTCTGC

AAAAACCTGCTAGAAAGAGCGGTGGAGTCCTTGGTGAAACCTCAGGCCAAGAAGAAGGCAGGCGACCAGGAAGAAGAGAGCTG TGAATTTTCCAGTGCT

CTAGAGTATTTGAAATTACTTCATTCTTTTGTGGACTCTGTGGGATTTGTGACCTCACCATTCTCCAGCAGTTCCGTGCTCAGGTCGGCCCTTG - UNI

6220 - GCCCCGATGTCATCTGCCGGTGGTGGACGTCCGCAGTCACCATGGCCATCAGCTGGCTCCAGGGAGACGATGCAGCTGTGCGCTCTCGTTTTA

CTGAAGTAGAGCGGGTCCCCAAGGCCCTGGAAGTGACCGA GAGTCCCTTGGTGAAGGCCGTCTTCTATACCTGTAGAGCCATGCATGCCTCCCTCTCTG

GGAAAGCTGACGGGCAGCAGAACTCCTTCTGTCACTGTGAGAGGGCCAGTGGTCACCTGTGGAGCAGTCTCAACGTCAGCGGCACTACTTCTGATCCTTC

ACTTAACCAT - UNI4849 - GTGATCCAGCTGTTCACCTGTGACCTGCTACTGTCGCTGAGGACAGCACTCTGGCAAAAGCAGGCCAGTGCCAGCCA

GCTCCTGGGTGAGACCTACCATGCATCCGGCACTGAGCTGGCCGGCTTCCAGCGGGACCTGGGCAGCCTTCGAAGGCTGGCCCATAGCTTCCGCCCAGCC

TACCGCAAG GTGTTCCTGCATGAAGCCACTGTGCGCCTGATGGCAGGAGCCAGCCCTACCCGTACACACCAGCTGCTGGAGCATAGCCTACGGCGGCGC

CCCACTCAGAACACCAAGCATG GAGAGGTAGACACCTGGCCTGGCCAACGAGAGCGAGCTACTGCCATCCTGCTGGCCTGCCGCCATCTTCCCCTCTCT

TTCCTGTCTTCCCCGGGCCAGCGGGCAGTGCTGCTGGCTGAAGCTGCCCGCACCCTGGAGAAGGTGGGTGACCGCCGTTCCTGCAGTGACTGCCAGCAGA

TGATTGTCAAGCTGGGCGGTGGCACTGCCATCGCTGCCTCCTGACCACCGTCTGGGGCCTGGTCCACTTCTTTCCACCTTTTTGTCTCTTTCTCCCAGGA

TCTTCCCTCTGTCTCCCAGACTGTCTCCCATCTGTTTCTCTCCCTCCTCCCAGAGCTGTGAGGATGAAGGCAAGACTGATTGTTCTGAGCTGTTACCTGC

CAAGGCTTTTGGATCATTTCGGGCCAGTAGGACCATGGGCAGAGCTCCTTAACACTGCTGTGGTAAATCCACGGTCCAAGCCCAGGCGGGCTGAGAAGAG

AGATGGCCTGAGCAGGAACGGAGCTCTCCTCAGTTGGAAGCAATGTGGGGCGCTGCGAGCCCCTCCCAGTCCTCTAGAGACTGTCTCCTTTCTGCCTCTG

GTTCTCTTTGTTGTTGTTACGTTTCATTCCAGTTTTTGTTTTTAATCAGGCTTTCTCTGGGAACTAGGTCTTTGCACCAGAGAGCATTTTGCATTCTGGA

CTTGATAGACGCACCCCTTTTTATACAGATGTTTTTATATGTGTGTGCTCAGGCCTGCCGAGATGCAGGGCAAAGTTGCTGTGGCATCTTTGTTCCTCTC

CCTGGGTCTGCACTCCCTCCCCTGTGCCTGACTAAGCCTTGTTCATTGTTCTTTCATCCTTACAAGGGACAGCCAGCCAAGGAGGAAAGGAGCCCAGCCC

TGGGGAGGTGGGTGGGAGGGAGGCAGGGGCAGGTCTAGGGATGGGTGAAAAATAATGTCGGCATTGTTTTTTAATTTTTTAAAAAATAAATGGTATCTTA

TTTAATTGTCCTGTTCCTTCCCACTCCTTCCCCCCCTCCCCCAGACGGCCGCCTGAGCTCAGGGTGGGCCCATGGGGCTGGACAGGATGAGGTCACCATT

GGGCCTGAGGGCCAGGGGTCTCCAGCATGACTTGTTTGCTCTCCCTCCCCCACCCTCACTCCTACCTCCCATAGAAGTGTATTCTTATCCCTAGTTCCTG

TCTGAGTAAGCCAGGGTGGCAGACGCTGGTCCCAAACCTCACCCAGCAACCAGCCTCTCATTTTCAGGGCAGGCAGCAGAGACCCGGGTCTCTTGCCTTG

AGATGGGGGGAGTCCTAGGAAGAAGAGTGGTCTGGTCCTGTTTCTGCAGACTGCTTGGCTCAGGGCTTCCTGAGAGACTTGAGAGGAACTGTCCCTCCTC

CCTCATGCTTCTCCTCATCCCTTCAAGCTGGTTGAAGAGAGTAGGCAGGGGCGGGGCCCCGAGGTGCTTCAACCCCACCTACTCTGCCTTCCACCTCTCC

CCAACCATCACTGTAATTTATGGCCCCCGCCGTGGGGCAGCCTAGCCCTTGTGTCTGTGTATATACTGTGCCTTTTCTCCTTGTCGAGGGGTGGGAGGGG

TTGGTTTTTCACTGAACAGGGGATATGCCTATGTCTTCATCAGTGTTGAAACATTCACCATGTGCTGGACGTAGGTTTTCAATAAACACAGATTGGTACC

ACC
Translation
MDESSELGVLETMETLTELGDELTLGDIDE - UNI5488 - - UNI8361 - EMLQFVSNQVGEFPDLFSEQLCSSFPGGGSNGGSGNNSSGRGNNG

GATDPAVQRSFSQVPLSTFSPSAASPQAPALQVKVSPTPPRATPVLQPRPQPQPQPPAQLQQQTVMITPTFSTAPQTRIIQQPLIYQNAATSFQV - UN

I8361 - VLQPQVQSLVTSPQVQPVTIQQQVQTVQAQRVLTQTANGTLQTLAPATVQTVAAPQVQQVP VLVQPQIIKTDSLVLTTLKTDGSPVMAAVQ

NPALTALTAPIQTAALQVP - UNI8521 - TLVGSNGTILTTMPVMMGQEKVPIKQVPGGVKQLDPPKEGERRTTHNIIEKRYRSSINDKIIELKDLV

MGTDAK - UNI2435 - MHKSGVLRKAIDYIKYLQQVNHKLRQENMVLKLANQKNK KLLKGIDLGSLVDSDVDLKIDDFNQNVLLMSPPASDSGSQA

GFSPYSIDSEPGSPLLDDAK VKDEPDSPPVALGMVDRSRILLCVLTFLGLSFNPLTSLLQWGGAHNTDQHPYSGSGRSVLSLESG GAGGWFDWMVPTL

LLWLVNGVIVLSVFVKLLVHGEPVIRPHSRPSVTFWRHRKQADLDLAK - UNI7417 - GDFAAAAANLQTCLSVLGRALPTSRLDLACSLSWNVIRY

SLQKLRLVRWLLKKVFQRWRATPATAAGFEDEAKSSARDAALAYHRLHQLHITG GKLPAGSACSDVHMALCAVNLAECAEEKILPSTLIEIHLTAAMGL

KTRCGGKLGFLA SYFLNRAQSLCGPEHSTVPDSLRWLCHPLGQKFFMERSWSIKSAAKESLYCAQRSPA ADPIAQVHQAFCKNLLERAVESLVKPQAK

KKAGDQEEESC CEFSSALEYLKLLHSFVDSVGFVTSPFSSSSVLRSALG - UNI6220 - GPDVICRWWTSAVTMAISWLQGDDAAVRSRFTEVERV

PKALEVTE ESPLVKAVFYTCRAMHASLSGKADGQQNSFCHCERASGHLWSSLNVSGTTSDPSLNH - UNI4849 - VIQLFTCDLLLSLRTALWQKQ

ASASQLLGETYHASGTELAGFQRDLGSLRRLAHSFRPAYRK VFLHEATVRLMAGASPTRTHQLLEHSLRRRPTQNTKHG GEVDTWPGQRERATAILLA

CRHLPLSFLSSPGQRAVLLAEAARTLEKVGDRRSCSDCQQMIVKLGGGTAIAAS
Transcript ENSMUST00000100393
Sequence
AAACATGGCGGCGGTTGGCACGGGGCGGTGAGGCGGTACCAGGTGGGGGCTGTCGGGTGTCATGGGCGGTGGCGGCGGTACCGCCTCCGCGTCTCCCTGA

GCTGGACCTCACGGGGGACTCTGCGCCAAGCTGGGCGATGGATGAGAGCAGCGAGCTGGGCGTTCTGGAGACCATGGAGACCCTCACGGAGCTGGGCGAT

GAGCTGACTCTCGGGGACATCGACG - UNI5488 - - UNI8361 - AGATGCTACAGTTTGTCAGCAATCAAGTGGGAGAGTTCCCTGATTTGTTT

TCAGAGCAACTTTGTAGCTCCTTCCCTGGAG - UNI813 - - UNI8361 - CTGCCTCCCCTCAGGCTCCGGCCCTGCAGGTCAAAGTCTCTCCTA

CCCCACCAAGGGCAACCCCTGTTCTCCAGCCGCGACCCCAGCCCCAGCCCCAACCTCCAGCTCAGCTGCAGCAGCAGACGGTGATGATCACCCCGACGTT

CAGCACCGCTCCGCAGACGAGGATCATCCAGCAGCCTTTGATATACCAGAACGCAGCGACCAGCTTTCAAG - UNI8361 - TCCTGCAGCCTCAAGT

GCAAAGCCTCGTGACGTCCCCGCAGGTGCAGCCCGTCACCATCCAGCAGCAGGTGCAGACGGTACAGGCCCAGCGGGTGTTGACGCAGACAGCCAATGGC

ACACTGCAGACCCTTGCCCCCGCCACGGTACAGACGGTCGCTGCGCCACAGGTGCAGCAGGTCCCG GTCCTGGTGCAACCTCAGATCATTAAGACAGAT

TCCCTTGTGTTGACCACGCTGAAGACAGATGGCAGCCCTGTCATGGCTGCAGTCCAGAACCCGGCCCTCACGGCCCTCACTGCCCCCATCCAGACAGCCG

CCCTTCAAGTGCCA - UNI8521 - ACCCTGGTGGGCAGCAACGGGACCATTCTGACCACAATGCCTGTGATGATGGGGCAAGAGAAAGTTCCTATCA

AGCAAGTGCCTGGCGGCGTGAAGCAGCTGGATCCTCCCAAAGAAGGAGAGAGGCGGACAACACACAATATCATTGAAAAGCGCTACCGGTCCTCCATCAA

CGACAAAATCATAGAGTTGAAGGACTTAGTCATGGGGACAGATGCCAAG - UNI2435 - ATGCACAAGTCTGGCGTTCTGAGGAAGGCCATTGATTA

CATCAAATATCTGCAGCAGGTCAATCACAAGCTGCGCCAGGAGAACATGGTGCTGAAGCTGGCCAATCAGAAAAACA AGCTCCTGAAGGGCATCGACCT

GGGCAGTCTGGTGGACAGTGATGTGGACTTGAAAATTGATGACTTTAACCAGAATGTCCTTCTGATGTCTCCGCCGGCCTCCGACTCCGGGTCCCAGGCC

GGCTTCTCTCCCTATTCCATTGACTCTGAGCCGGGCAGCCCTCTGCTGGATGACGCAAAG GTCAAGGATGAACCGGACTCTCCTCCTGTGGCACTGGGC

ATGGTGGACCGCTCTCGAATCCTCTTATGTGTCCTCACCTTCCTGGGCCTCTCCTTTAACCCCTTGACTTCCTTGCTGCAGTGGGGAGGGGCCCACAACA

CTGACCAGCACCCATACTCAGGCTCGGGCCGCAGTGTACTGTCACTGGAGTCAG GTGCTGGGGGCTGGTTTGACTGGATGGTTCCAACTCTCCTCCTGT

GGCTGGTAAATGGTGTGATTGTCTTGAGCGTCTTTGTGAAGCTGTTGGTCCACGGGGAGCCGGTGATTCGCCCACACTCACGCCCCTCAGTCACCTTCTG

GAGACACCGGAAGCAGGCAGACCTAGACCTCGCCAAA - UNI7417 - GGTGATTTCGCAGCTGCTGCTGCCAACCTACAAACCTGCTTATCCGTGCT

GGGCCGGGCGCTGCCCACCTCCCGCCTGGACTTGGCCTGCAGCCTCTCCTGGAATGTGATCCGCTACAGCCTGCAGAAGCTGCGCCTGGTACGCTGGTTA

CTCAAGAAGGTCTTCCAGCGCTGGCGGGCTACTCCCGCCACTGCAGCTGGCTTTGAGGATGAGGCTAAGAGCAGCGCAAGGGATGCGGCACTGGCCTACC

ACAGGCTGCACCAGCTGCACATCACAG GGAAGCTTCCGGCGGGATCTGCCTGTTCAGATGTGCACATGGCTCTGTGTGCTGTGAACCTGGCCGAGTGTG

CGGAGGAGAAAATCCTACCAAGCACACTGATTGAGATCCACCTGACAGCGGCCATGGGGCTCAAGACCCGCTGTGGAGGCAAGCTGGGCTTCTTGGCT A

GCTACTTCTTAAATCGTGCCCAGAGTCTGTGTGGCCCAGAGCATAGCACTGTCCCCGACTCCCTGCGCTGGCTATGCCATCCCTTGGGCCAGAAGTTTTT

CATGGAGCGAAGCTGGTCGATCAAGTCAGCAGCCAAGGAGAGCCTGTACTGCGCCCAGAGGAGCCCAG CTGACCCCATTGCCCAGGTACACCAGGCGTT

CTGCAAAAACCTGCTAGAAAGAGCGGTGGAGTCCTTGGTGAAACCTCAGGCCAAGAAGAAGGCAGGCGACCAGGAAGAAGAGAGCTG TGAATTTTCCAG

TGCTCTAGAGTATTTGAAATTACTTCATTCTTTTGTGGACTCTGTGGGATTTGTGACCTCACCATTCTCCAGCAGTTCCGTGCTCAGGTCGGCCCTTG -

 UNI6220 - GCCCCGATGTCATCTGCCGGTGGTGGACGTCCGCAGTCACCATGGCCATCAGCTGGCTCCAGGGAGACGATGCAGCTGTGCGCTCTCGT

TTTACTGAAGTAGAGCGGGTCCCCAAGGCCCTGGAAGTGACCGA GAGTCCCTTGGTGAAGGCCGTCTTCTATACCTGTAGAGCCATGCATGCCTCCCTC

TCTGGGAAAGCTGACGGGCAGCAGAACTCCTTCTGTCACTGTGAGAGGGCCAGTGGTCACCTGTGGAGCAGTCTCAACGTCAGCGGCACTACTTCTGATC

CTTCACTTAACCAT - UNI4849 - GTGATCCAGCTGTTCACCTGTGACCTGCTACTGTCGCTGAGGACAGCACTCTGGCAAAAGCAGGCCAGTGCCA

GCCAGCTCCTGGGTGAGACCTACCATGCATCCGGCACTGAGCTGGCCGGCTTCCAGCGGGACCTGGGCAGCCTTCGAAGGCTGGCCCATAGCTTCCGCCC

AGCCTACCGCAAG GTGTTCCTGCATGAAGCCACTGTGCGCCTGATGGCAGGAGCCAGCCCTACCCGTACACACCAGCTGCTGGAGCATAGCCTACGGCG

GCGCCCCACTCAGAACACCAAGCATG GAGAGGTAGACACCTGGCCTGGCCAACGAGAGCGAGCTACTGCCATCCTGCTGGCCTGCCGCCATCTTCCCCT

CTCTTTCCTGTCTTCCCCGGGCCAGCGGGCAGTGCTGCTGGCTGAAGCTGCCCGCACCCTGGAGAAG AGCTGTGAGGATGAAGGCAAGACTGATTGTTC

TGAGCTGTTACCTGCCAAGGCTTTTGGATCATTTCGGGCCAGTAGGACCATGGGCAGAGCTCCTTAA
Translation
MDESSELGVLETMETLTELGDELTLGDIDE - UNI5488 - - UNI8361 - EMLQFVSNQVGEFPDLFSEQLCSSFPGA - UNI813 - - UNI

8361 - AASPQAPALQVKVSPTPPRATPVLQPRPQPQPQPPAQLQQQTVMITPTFSTAPQTRIIQQPLIYQNAATSFQV - UNI8361 - VLQPQVQ

SLVTSPQVQPVTIQQQVQTVQAQRVLTQTANGTLQTLAPATVQTVAAPQVQQVP VLVQPQIIKTDSLVLTTLKTDGSPVMAAVQNPALTALTAPIQTAA

LQVP - UNI8521 - TLVGSNGTILTTMPVMMGQEKVPIKQVPGGVKQLDPPKEGERRTTHNIIEKRYRSSINDKIIELKDLVMGTDAK - UNI243

5 - MHKSGVLRKAIDYIKYLQQVNHKLRQENMVLKLANQKNK KLLKGIDLGSLVDSDVDLKIDDFNQNVLLMSPPASDSGSQAGFSPYSIDSEPGSPL

LDDAK VKDEPDSPPVALGMVDRSRILLCVLTFLGLSFNPLTSLLQWGGAHNTDQHPYSGSGRSVLSLESG GAGGWFDWMVPTLLLWLVNGVIVLSVFV

KLLVHGEPVIRPHSRPSVTFWRHRKQADLDLAK - UNI7417 - GDFAAAAANLQTCLSVLGRALPTSRLDLACSLSWNVIRYSLQKLRLVRWLLKKV

FQRWRATPATAAGFEDEAKSSARDAALAYHRLHQLHITG GKLPAGSACSDVHMALCAVNLAECAEEKILPSTLIEIHLTAAMGLKTRCGGKLGFLA SY

FLNRAQSLCGPEHSTVPDSLRWLCHPLGQKFFMERSWSIKSAAKESLYCAQRSPA ADPIAQVHQAFCKNLLERAVESLVKPQAKKKAGDQEEESC CEF

SSALEYLKLLHSFVDSVGFVTSPFSSSSVLRSALG - UNI6220 - GPDVICRWWTSAVTMAISWLQGDDAAVRSRFTEVERVPKALEVTE ESPLVK

AVFYTCRAMHASLSGKADGQQNSFCHCERASGHLWSSLNVSGTTSDPSLNH - UNI4849 - VIQLFTCDLLLSLRTALWQKQASASQLLGETYHASG

TELAGFQRDLGSLRRLAHSFRPAYRK VFLHEATVRLMAGASPTRTHQLLEHSLRRRPTQNTKHG GEVDTWPGQRERATAILLACRHLPLSFLSSPGQR

AVLLAEAARTLEK SCEDEGKTDCSELLPAKAFGSFRASRTMGRAP

For any suggestions or comments, please send an email to unitrap@crg.es