Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000022474 (Pmm1)
Chromosomal location
Chr 15: 81781542 - 81791294 (-)
Description
phosphomannomutase 1 Gene [Source:MGI (curated);Acc:Pmm1-001]
RefSeq_dna
NM_013872 
RefSeq_peptide
NP_038900.1 
UniGene
Mm.18939 
MGI
MGI:1353418 
Uniprot/SWISSPROT
O35621 
Uniprot/SPTREMBL
Q91W01 Q545Q8 Q9D6D9 
Human Ortholog
ENSG00000100417 (PMM1)
Omim not available
UniTrap UNI15916
Vector Insertion
Chr 15: 81788325 - 81788341
Public Clones not available
Private Clones OST470345 (lexicon) OST272541 (lexicon) OST211309 (lexicon) OST210867 (lexicon)
OST65559 (lexicon) OST37175 (lexicon)
Severity of mutation (?) Insertion after 11% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI29847
Vector Insertion
Chr 15: 81788325 - 81791295
Public Clones (sanger) D170F02 (ggtc) E047A02 (ggtc)
Private Clones not available
Severity of mutation (?) Insertion after 11% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI10035
Vector Insertion
Chr 15: 81786869 - 81788222
Public Clones XC277 (baygenomics) XC283 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 17% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI21586
Vector Insertion
Chr 15: 81786179 - 81786598
Public Clones Ayu21-T149 (egtc)
Private Clones OST325070 (lexicon)
Severity of mutation (?) Insertion after 32% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI20592
Vector Insertion
Chr 15: 81783231 - 81786078
Public Clones not available
Private Clones OST357777 (lexicon)
Severity of mutation (?) Insertion after 49% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI5744
Vector Insertion
Chr 15: 81782470 - 81783154
Public Clones CSI408 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 61% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI18592
Vector Insertion
Chr 15: 81782043 - 81782353
Public Clones not available
Private Clones OST420031 (lexicon)
Severity of mutation (?) Insertion after 80% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000071462
Sequence
CTCTGTCGCACGCGACCCTGGCGGTGGCTGCAGCGACAGCGCTTGGCGCGCGGAGCTACAGCCATGGCAGTCGCCGTCGAGGGCGCCCGCAGGAAAGAGC

GCATCCTCTGCCTGTTTGACGTGGACGGGACCCTCACGCCAGCTCGCCAG - UNI15916 - - UNI29847 - AAAATTGACCCTGAG - UNI10

035 - - UNI15916 - - UNI29847 - ACGATCCAGAACCACCTGGGGGAGGAGCTCCTGCAGGACTTGATCAACTTCTGCCTTAGCTACATGGC

CCTGCTCAGACTGCCCAAGAAGCG - UNI21586 - TGGGACCTTCATTGAGTTCCGGAATGGCATGCTGAACGTCTCGCCCATTGGCCGCAGCTGCA

CCCTGGAGGAGAGGATCGAGTTCTCGGAACTGGACAAG - UNI20592 - AAGGAGAAGATCCGGGAGAAGTTTGTGGAAGCCTTGAAGACAGAGTTT

GCTGGCAAGGGGCTGCGGTTCTCCCGAG - UNI5744 - GAGGCATGATAAGCTTCGATGTCTTCCCCGAGGGCTGGGATAAGCGCTACTGCCTGGAC

AGCCTGGATGAAGACAGCTTTGACATCATCCACTTCTTTGGAAATGAGACCAGTCCT - UNI18592 - GGCGGGAATGACTTTGAGATCTATGCGGA

CCCCCGGACTGTCGGCCATAGCGTGGTCTCCCCTCAGGACACTGTACAGCGATGCCGTGAGCTCTTCTTCCCAGAGACAGCCCACGAGGCGTGACTGGGC

CCACAGCTGAGCACTGGGACCTTCAAAGAGCTCTGACCAGGCCTGAAGATAGAACCATTGGGTGCCACGGTTCCCATCCCACTGGCCCAACACGTAGCAT

CCTGTGGGGGCACTGCAGGGTCACCCACACAGGACCAACGTCTGTGTGGGAACTGTCCCCAGCCAGGTGGCTCCTGACGAGACGCATACCTGCTCTCTAC

CCTGATGGTCCTGGCCTCTGATGCTGCTGGTTTTGGGGACAGAACAGGTCTCACCACAGGGTGGCATGGGAGTTGTGCTATGGAGCCTGCTGGCCACAGA

CTGACAAGGGACAGAATGGCAGAGAAGGGGCATTACTTAAAGGACTCTGTCACAGATATTAAAGTTCCCAAG
Translation
MAVAVEGARRKERILCLFDVDGTLTPARQ - UNI15916 - - UNI29847 - KIDPE - UNI10035 - - UNI15916 - - UNI29847 -

 TIQNHLGEELLQDLINFCLSYMALLRLPKKR - UNI21586 - RGTFIEFRNGMLNVSPIGRSCTLEERIEFSELDK - UNI20592 - KEKIRE

KFVEALKTEFAGKGLRFSRG - UNI5744 - GGMISFDVFPEGWDKRYCLDSLDEDSFDIIHFFGNETSP - UNI18592 - GGNDFEIYADPRTV

GHSVVSPQDTVQRCRELFFPETAHEA
Transcript ENSMUST00000023112
Sequence
CTCTGTCGCACGCGACCCTGGCGGTGGCTGCAGCGACAGCGCTTGGCGCGCGGAGCTACAGCCATGGCAGTCGCCGTCGAGGGCGCCCGCAGGAAAGAGC

GCATCCTCTGCCTGTTTGACGTGGACGGGACCCTCACGCCAGCTCGCCAG - UNI15916 - - UNI29847 - AAAATTGACCCTGAGGTATCGGC

CTTCCTGCAGAAGCTACGAAGCAGGGTACAGATCGGCGTGGTGGGTGGCTCTGACTACTCTAAGATCGCCGAGCAGCTGGGAGAGGGGGATGAAG - UN

I10035 - TCATTGAGAAGTTTGACTACGTGTTTGCTGAGAATGGGACAGTGCAGTATAAACACGGACGGCTACTCTCCAAACAG ACGATCCAGAACC

ACCTGGGGGAGGAGCTCCTGCAGGACTTGATCAACTTCTGCCTTAGCTACATGGCCCTGCTCAGACTGCCCAAGAAGCG - UNI21586 - TGGGACC

TTCATTGAGTTCCGGAATGGCATGCTGAACGTCTCGCCCATTGGCCGCAGCTGCACCCTGGAGGAGAGGATCGAGTTCTCGGAACTGGACAAG - UNI2

0592 - AAGGAGAAGATCCGGGAGAAGTTTGTGGAAGCCTTGAAGACAGAGTTTGCTGGCAAGGGGCTGCGGTTCTCCCGAG - UNI5744 - GAGG

CATGATAAGCTTCGATGTCTTCCCCGAGGGCTGGGATAAGCGCTACTGCCTGGACAGCCTGGATGAAGACAGCTTTGACATCATCCACTTCTTTGGAAAT

GAGACCAGTCCT - UNI18592 - GGCGGGAATGACTTTGAGATCTATGCGGACCCCCGGACTGTCGGCCATAGCGTGGTCTCCCCTCAGGACACTGT

ACAGCGATGCCGTGAGCTCTTCTTCCCAGAGACAGCCCACGAGGCGTGACTGGGCCCACAGCTGAGCACTGGGACCTTCAAAGAGCTCTGACCAGGCCTG

AAGATAGAACCATTGGGTGCCACGGTTCCCATCCCACTGGCCCAACACGTAGCATCCTGTGGGGGCACTGCAGGGTCACCCACACAGGACCAACGTCTGT

GTGGGAACTGTCCCCAGCCAGGTGGCTCCTGACGAGACGCATACCTGCTCTCTACCCTGATGGTCCTGGCCTCTGATGCTGCTGGTTTTGGGGACAGAAC

AGGTCTCACCACAGGGTGGCATGGGAGTTGTGCTATGGAGCCTGCTGGCCACAGACTGACAAGGGACAGAATGGCAGAGAAGGGGCATTACTTAAAGGAC

TCTGTCACAGATATTAAAGTTCCCAAG
Translation
MAVAVEGARRKERILCLFDVDGTLTPARQ - UNI15916 - - UNI29847 - KIDPEVSAFLQKLRSRVQIGVVGGSDYSKIAEQLGEGDEV - U

NI10035 - VIEKFDYVFAENGTVQYKHGRLLSKQ TIQNHLGEELLQDLINFCLSYMALLRLPKKR - UNI21586 - RGTFIEFRNGMLNVSPIG

RSCTLEERIEFSELDK - UNI20592 - KEKIREKFVEALKTEFAGKGLRFSRG - UNI5744 - GGMISFDVFPEGWDKRYCLDSLDEDSFDIIH

FFGNETSP - UNI18592 - GGNDFEIYADPRTVGHSVVSPQDTVQRCRELFFPETAHEA

For any suggestions or comments, please send an email to unitrap@crg.es