Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000022490 (Ppp1r1a)
Chromosomal location
Chr 15: 103360710 - 103368423 (-)
Description
protein phosphatase 1, regulatory (inhibitor) subunit 1A Gene [Source:MGI Symbol;Acc:MGI:1889595]
RefSeq_dna
NM_021391 
RefSeq_peptide
NP_067366.1 
UniGene
Mm.143788 
MGI
MGI:1889595 
Uniprot/SWISSPROT
Q9ERT9 
Uniprot/SPTREMBL
Q9CW88 
Human Ortholog
ENSG00000135447 (PPP1R1A)
Omim not available
UniTrap UNI28595
Vector Insertion
Chr 15: 103363926 - 103364780
Public Clones not available
Private Clones OST26752 (lexicon)
Severity of mutation (?) Insertion after 28% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000023133
Sequence
CGCGCCGAGCCAGGAGCTGCAAGCCGAGCGCCGGGCTGGGGCCAGGGCCGGAGCGCAACAGAGAGGGAGCGCGCCCGCCCCAGCCCGAGGTCCGCCGCTG

CCTGACCGGGAGCCATGGAGCCCGACAACAGCCCACGGAAGATCCAGTTTACGGTCCCGCTGCTGGAGCCTCACCTGGACCCGGAGGCGGCGGAGCAG A

TTCGGAGGCGCCGCCCCACCCCTGCCACACTTGTGCTGACCAGTGATCAGTCCTCCCCAG - UNI28595 - AAATAGATGAAGACCGGATCCCCAAC

TCACTTCTCAAG TCCACCTTGTCAATGTCTCCACGGCAACGGAAGAAGATGACAAGGACCACACCCACCATGAAAG AGCTCCAGACGATGGTTGAACA

TCACCTAGGGCAACAGAAGCAAGGGGAAGAACCTGAGGGAGCCACTGAGAGCACAGGGAACCAGGAGTCCTGCCCACCTGGGATCCCAGACACAGGCTCG

GCGTCAAGGCCAGATACCCCCGGGACAGCACAAA AGTCTGCAGAATCCAACCCCAAGACTCAGGAGCAGTGTGGTGTGGAGCCCAGAACAGAGGATTCT

TCAGCCCACATGCTACCACTGGATTCCCAGGGAGCCAGCTTG GTCTGACAGAAGTTGGTATCCGGGGATCACCACTGCAGTGTGGAAATTCATGGACAC

TGGATGTTTCTTAATCTCTTGTTTTTAAAAAGTGATAAATTTGGTGTTAGGTCCTTGGAGCTTTTCTTCTTTCCAGCCCGGGGATCCCTTCCTCCTTCAG

CTCTTGTCTGCACCCCACTGCCCCCACCCTCAGGACCGATTAAGGAAGGAAATAGCAAACTGACAAAAGCCTAGCCTCCACTAGCAAAATAGAAAAATAG

ACGTCTGGAAGTAGGAGGTCGCCTCAAGGTTTTCCTTTGTTACTGTGGAAAGCTCTGCCCACAGAGCAGGTTAGCCTACTTGGGAGACTGCTGCTCTAAA

GCGGGTACCCAGACCAGTGAGGGTTTGCCAAAGCGCCATCTGCTGGACATAAAGGGGAAGTGCATCTTGTCCCTAGCTCCCTGAGAAACCTCCAATTCTG

TGGCCACTGTTCCTTGTACAAACCTGACACAAAGACTGTCAGAAAACACTGTGGCTAGAAACCCAAAGGGCCACCTCTCCCATTGTCCTACATCCTAAGG

TCAGAGCAAGACTAACACCATGCACAAATAGAGAAATGGTCTGTGATCCTAGCCAGGCTTCTGCTGCTGATTCTGATTTTCCCAAAGAATTAAAGCGATG

AAGGGAGAAGACAA
Translation
MEPDNSPRKIQFTVPLLEPHLDPEAAEQ IRRRRPTPATLVLTSDQSSPE - UNI28595 - EIDEDRIPNSLLK STLSMSPRQRKKMTRTTPTMKE

 ELQTMVEHHLGQQKQGEEPEGATESTGNQESCPPGIPDTGSASRPDTPGTAQK KSAESNPKTQEQCGVEPRTEDSSAHMLPLDSQGASL V

For any suggestions or comments, please send an email to unitrap@crg.es