Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000022498 (Txndc11)
Chromosomal location
Chr 16: 11075014 - 11134706 (-)
Description
thioredoxin domain containing 11 Gene [Source:MGI (curated);Acc:Txndc11-001]
RefSeq_dna
NM_029582 
RefSeq_peptide
NP_598866.1 NP_083858.1 
UniGene
Mm.392925 Mm.291015 Mm.445578 
MGI
MGI:1923620 
Uniprot/SWISSPROT
Q8K2W3 
Uniprot/SPTREMBL
Q3TWZ5 Q3U024 Q3U194 Q3U1N6 
Human Ortholog
ENSG00000153066 (TXNDC11)
Omim not available
UniTrap UNI23816
Vector Insertion
Chr 16: 11128797 - 11134360
Public Clones not available
Private Clones OST243994 (lexicon)
Severity of mutation (?) Insertion after 32% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI35556
Vector Insertion
Chr 16: 11093908 - 11104753
Public Clones IST12999F8 (tigm) IST10952D7 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 28% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000118679
Sequence
GTGAGCGCCGCTGGCTGCGAGGTCCGGGAGTGACGTGCGGGGCCGGGTCCCCGGGCCCGAGGTGGCGGCAGCGACGGTATAAAGCCGGCCACGGGGAGCA

TGTAATGTCGGAATGCGGAGGCCGCGGCGGCGGCGGCGGGAACAACAGCGAGGACGCCGAGGACGAGGGTGGCGGCCCCAAGGGCTCAGGCTCCCTCAGC

CCTGCCGGGGCGGCGGCGTCCTTGGAGGGCCGGATCCGCCGCGGCTTGCGCGGCGCCTCGCTTATGGCGCGCCAGCGGCCAGAGCTGCTGTGCGGGGCCG

TGGCTCTCGGCTGCGCCCTGCTCTTCGCCCTCAAGTTCACTTGCAG - UNI23816 - TCGAGCAAAAGACGTGATAATACCAGCAAAGCCGCCTGTC

AGCTTTTTCTCCTCGAGATCTCCGGTCCTTGACCTCTTCCAGGGGCAGCTGGACTATGCTGACCATGTCCGCCAGGATTCTGAGGTGGTGGTGCTGTTCT

TCTATGCCCCGTGGTGTGGCCAGTCCATCGCTGCCAGGGCAGAAATTGAGCAGGCAGCCAGCCGGCTTTCTGATCAG GTGTTGTTTGTGGCAATAAACT

GTTGGTGGAACCAGGGGAAATGCAGAAAACAGAAGCATTTCTTCTATTTTCCTGTGATACATCTGTATCATCGGAG TTTTGGACCAATCGAATACAAAG

GCCCCATGAGTGCTGTTTACATTGAGAAGTTTGTCCGCCGGGCGATGAAGCCGCTTCTCTACATCCCGTCTCAATCAGCATTGCTAGACTTTCTCTCCAG

CTATGAGGTACCTGTCTTTCTTATCGCCTGCTCCCAAGGCTTTTCACTTGCTAGAACTGGATTGTTTGTATTAAGTGAGTTTTAGTTTACTTTGTTTTAT

TTTGGTGTATATTAATTAATTGTACAAGATAGTAGGTTTTTTTTTTGTTTTTTTGTTTTTTTTTTTTCCAAGACAGGGTTCCTCTGTATAGCCCTGGCTG

TCCTGGAACTCACTCTGTAGACCAGGCTGGCCTCGAACTCAGAAATCCGCCTGCCTCTGCCTCCTAAGTGCTGGGATCAAAGGCGTGCGCCACCACTGCC

CGGCAATAGTAGGTTTCATTATGACATTTTTATACTTTTAAAAAGTCTCCTGGATTTTAGCAATTAAAAAACTTACATTGGTGGCTGGAGAGCTGGTTTA

GAGATTAAGAGCACATACTGTCCTTTCTAAGACCCCAGTTTAATTCCCCACACCCATTAGGTGACTTGAAACTGACTGTAACTCTAGTTTCGGGAGATCT

CATACTCCAGTTAAGAGCTCCCTGAGATTCTAATTTTAAGGACAGCTGGCTAAGTGAGCATTAAAAGGCCAGACTACTTGCAAAATCTTATCTCTGTTTT

GTTTGGAGATTTTAAACAGATGTTGTTCTTGTCTCACAGTTGACTAGGATATGGAATTAGTTCATAGTTTCTATGCAGCTACTCTAAGAATATTCTGTGG

CCTTATAATATTGCACAATGAGGACCTGGCTTTTCTTGTCAGTTTTAGTTTAGCTTTTGACTCCGTGGTTAAGAACACTTGTGCCTTTCCTACATAACTC

AGGTTCAATTCTAGCACCTACATCAGTTGGCTCACAGCTGCCTGTGCCTTCAGTTCTAGGGTATTTGAAGCCCTCTTCTGGCTTCCATGAGCATGCCCAC

ACATACACATAAATAAATAATAAAATAATTGTTAAAGGTTGATTTCGTATGTATGGGTGTTTTGTGTGCTTGTATGCCGGTGCACCAAATATCCCGGTGT

CCACAGAAGGATGAAGAGGATGTTGGGCTGCCCTAGGACTAGAGTCACAGATAGCAGCACTGTGTAGATGCTAGGAGTTTAACCCAGATTGTCTGGAAGA

GCAGCCAGTGTGCTTAACTGTTGGGACTAAACTTTGATCTTTTTTGCAAGAGTAGCAAGTTAACTGGAGCTAGCTCTCCAGCCCCTACAACAAATCTTTA

TTTAAAACAAAACAAAAAACCAAAATAACAACAACAAAAACCCTGGAAATATACTCCTTTCTGATTATTTAAGTCCTTTTGGTTTTTGGTTTTTTGAGAC

AGGGTTTCTCTGGGTAGTCCTGGCTGTCCTGGAACTCTCTATAGTCAAGGCCTTTTTAAATAGAAAATATTTTAGCTTACTAATATTGCTTTTTTTCCAG

TGGCCCTGTTGCCAGCTTCAATACCTCTTAAATTATTGTTATTTTAAGATTTTATTCTCTTGGGTTGCTGGGTGGGGTAGTGCATGCCTTTAATCCTAGT

ACTTGGGAGACAGAGGCAGGTAGAGTGTGTTCGAGGCCAACCTGTTCTACATTGTGAATTTAGGCCAGCAAAGCATACATATTTTAAGAACAAAAACCTA

ATCCTTAATTTGCATTATCTTTTAAAATAACTTAAAAATTCATTTATTTAAATTTATTTATTTATTTATTTATTTATTTATCTTTTGAGACAGGGTCATC

CTGACTAGCCTAGAACTCACAACGTAGACTAGGCTGGCTTGGGACTCATAGAGATCACCTGCCTTTGCCCCTTGAGCACTGGGATTAAAGGTGTGCACCA

CCACATTTAGGTTAAAATAGTTTTTAGAAAAAAATATTTTTGTCGTGTGTATGTTTGTGAGTCTGATGTCACTTGTTTATAAGTGCCTTTGGAGGCCAGA

AGAGGGCACTGGATGCCCTGGAACTAGAGCTTCAGCACCATGTGGGTATAGGGACTAAACTTGATTTTTTTTGCAAGAGTATCAAGTGCTCTTAGCTGCT

AAGCCATCTTCTCTCCAGTATCTGAGTTTTCTTCTTTGAGGTAGGGATCTCATGAGTCCCAGCTCAACCTTGAGCTCCGAGCACAGTTGAGTCTGATCTA

GGGCCAGTGACCCCATTCCTCACCTCCTGAGTTGTTTGGGGACTTGAGATGAGGGCAGTGTTTTGTTTTGTTTTGTTTTTTTAAAGATTTATTTATTATT

ACACAGAAGTATACTGTAGCTGTCTTTGAACACACCAGAAGAGGGCACCAGATCTCATTACGGGTGGTTGTGAGCCACTATGTGGTTGCTGGGATTTGAA

CTCAGGACCTTCAGAAGAACAGTCAGTGCTCTTAACCGCTGAGCCATCTCTCCAGCCCCCTTTGTTTTTGTTTTGAGGGGGTCTTGGAAGTAGGGTTAAT

AGTTAGTCCAAGCTGACCTCAGACCCTCAGCAGTCTTACAGCCTCAGTGCTCCTATAGATTGGCAGTTAGCACCTGAGCCACTGGAGGTAGTTCTCCAAA

CTAGTGAAAAACCTGATGTCAGGTTTAAGTCAAAGCTTAACTCTGCTACTGCCTAACTCTATGGCCTTGGGCTGATGATTTAGTCTCCTTATTCTCATTT

ATAAAGCAGAAGTAATCTAGATAAGACAAATCTCTAAGCAGTGGGGAGGGCAGAGGCAGACTGATCTGCATAGTGAGACTCTCAGAAAACAGAAAAACAA

GTAAAAATTAAGTAAAAAAAAAAAAAAAAAAAAAAGAAA
Translation
MSECGGRGGGGGNNSEDAEDEGGGPKGSGSLSPAGAAASLEGRIRRGLRGASLMARQRPELLCGAVALGCALLFALKFTCS - UNI23816 - SRAKD

VIIPAKPPVSFFSSRSPVLDLFQGQLDYADHVRQDSEVVVLFFYAPWCGQSIAARAEIEQAASRLSDQ VLFVAINCWWNQGKCRKQKHFFYFPVIHLYH

RS SFGPIEYKGPMSAVYIEKFVRRAMKPLLYIPSQSALLDFLSSYEVPVFLIACSQGFSLARTGLFVLSEF
Transcript ENSMUST00000115818
Sequence
GGCCGGGTCCCCGGGCCCGAGGTGGCGGCAGCGACGGTATAAAGCCGGCCACGGGGAGCATGTAATGTCGGAATGCGGAGGCCGCGGCGGCGGCGGCGGG

AACAACAGCGAGGACGCCGAGGACGAGGGTGGCGGCCCCAAGGGCTCAGGCTCCCTCAGCCCTGCCGGGGCGGCGGCGTCCTTGGAGGGCCGGATCCGCC

GCGGCTTGCGCGGCGCCTCGCTTATGGCGCGCCAGCGGCCAGAGCTGCTGTGCGGGGCCGTGGCTCTCGGCTGCGCCCTGCTCTTCGCCCTCAAGTTCAC

TTGCAG - UNI23816 - TCGAGCAAAAGACGTGATAATACCAGCAAAGCCGCCTGTCAGCTTTTTCTCCTCGAGATCTCCGGTCCTTGACCTCTTCC

AGGGGCAGCTGGACTATGCTGACCATGTCCGCCAGGATTCTGAGGTGGTGGTGCTGTTCTTCTATGCCCCGTGGTGTGGCCAGTCCATCGCTGCCAGGGC

AGAAATTGAGCAGGCAGCCAGCCGGCTTTCTGATCAG GTGTTGTTTGTGGCAATAAACTGTTGGTGGAACCAGGGGAAATGCAGAAAACAGAAGCATTT

CTTCTATTTTCCTGTGATACATCTGTATCATCGGAG TTTTGGACCAATCGAATACAAAGGCCCCATGAGTGCTGTTTACATTGAGAAGTTTGTCCGCCG

GGCGATGAAGCCGCTTCTCTACATCCCGTCTCAATCAGCATTGCTAGACTTTCTCTCCAGCTATGAG AAGCAACAGGCCACCCAGTACTGA
Translation
MSECGGRGGGGGNNSEDAEDEGGGPKGSGSLSPAGAAASLEGRIRRGLRGASLMARQRPELLCGAVALGCALLFALKFTCS - UNI23816 - SRAKD

VIIPAKPPVSFFSSRSPVLDLFQGQLDYADHVRQDSEVVVLFFYAPWCGQSIAARAEIEQAASRLSDQ VLFVAINCWWNQGKCRKQKHFFYFPVIHLYH

RS SFGPIEYKGPMSAVYIEKFVRRAMKPLLYIPSQSALLDFLSSYE KQQATQY
Transcript ENSMUST00000118362
Sequence
GAGCGCCGCTGGCTGCGAGGTCCGGGAGTGACGTGCGGGGCCGGGTCCCCGGGCCCGAGGTGGCGGCAGCGACGGTATAAAGCCGGCCACGGGGAGCATG

TAATGTCGGAATGCGGAGGCCGCGGCGGCGGCGGCGGGAACAACAGCGAGGACGCCGAGGACGAGGGTGGCGGCCCCAAGGGCTCAGGCTCCCTCAGCCC

TGCCGGGGCGGCGGCGTCCTTGGAGGGCCGGATCCGCCGCGGCTTGCGCGGCGCCTCGCTTATGGCGCGCCAGCGGCCAGAGCTGCTGTGCGGGGCCGTG

GCTCTCGGCTGCGCCCTGCTCTTCGCCCTCAAGTTCACTTGCAG - UNI23816 - TCGAGCAAAAGACGTGATAATACCAGCAAAGCCGCCTGTCAG

CTTTTTCTCCTCGAGATCTCCGGTCCTTGACCTCTTCCAGGGGCAGCTGGACTATGCTGACCATGTCCGCCAGGATTCTGAGGTGGTGGTGCTGTTCTTC

TATGCCCCGTGGTGTGGCCAGTCCATCGCTGCCAGGGCAGAAATTGAGCAGGCAGCCAGCCGGCTTTCTGATCAG GTGTTGTTTGTGGCAATAAACTGT

TGGTGGAACCAGGGGAAATGCAGAAAACAGAAGCATTTCTTCTATTTTCCTGTGATACATCTGTATCATCGGAG TTTTGGACCAATCGAATACAAAGGC

CCCATGAGTGCTGTTTACATTGAGAAGTTTGTCCGCCGGGCGATGAAGCCGCTTCTCTACATCCCGTCTCAATCAGCATTGCTAGACTTTCTCTCCAGCT

ATGAG - UNI35556 - CCTGGAGTACTCGGATACTTTGAATTCAGCGGTTCACCCCAGCCTCCTGGTTACTTGACCTTCTTCACCTCAGCACTGCAT

TCGTTAAAGAAAG - UNI35556 - ATTACCTAGGAACAGTGCGATTTGGGGTTATCACAGATAAACACCTTGCGAGACTGGTATCCTTAGTGCACTC

TGGAAGTGTGTATTTACATAGACATTTCAACACATCACTT - UNI35556 - GTCTTCCCCAGGGAAGTCATGAACTTCACAGCTGAGAACATCTATA

AGTGGGCCTCAGAAAACCAGGAGACCCTCTTCCGATGGCTACAGCCTCATGGAGGCAAGAGTCTGCTGTTGAACAATGAGCTGAAGAAAGGACCAGCACT

CTTCCTGTTCATACCGTTTGATCCCCTAGCCGAGAGACATCCTCTTCTAGATGAG ATCACCGAAGTGGCCTTGGAATACAATAACTGTCATGGGGACCA

GGTGGTAGAGCGCCTCCTTCAGCACCTGCGGCGGGTAGAGGCACCTGTGCTCCAGTCCCTGGCACCAGAGCTGCCAGCTTCACTGCCTGATACTCAGCTG

ATGGCAGCATCCCCCTGCTGTAACACGGTGGTGCTGCCACAGGGGCCAGCCCTCTCCAGGACTCACAATGTCTGTGAGCTGTGTGTCAACCAGACAGTGG

GTGGTACCAGGCCTAGCTCAGTGAGTGTGCCACAGTGCAGCTTCTTCGAGATGGCAGCCGCTCTGGATTCTTTCTACCTCAAGGAGCAGACTTTTTATCA

TGTGGTGTCGGGCAGCATAGAATGCAGCAATTTTTTAACCTCCTATAGCCCTTTCAGCTACTACACTGCATGTTGCAGGACCATATCCCGGGGCATGGCA

AGCTTTACTGGCTCTGAACAGAATGTCTTGACAGCCCCAGCCATCGAGTTCTCTTCCTTAGAGAAGAGCTGTGAGGCCACTGCCCCGAGCTCCATTCCTC

ACATTGAGGAGAACAGGTACCGCTTTCCTCAAGTGGGCCTCACTAGCACAGCCTTCACGGGCCTGAGCTGCAGAACCAACAAGACCCTGAACATCTACCT

TTTGGATTCCAATTTATTTTGGTTATATGCAGAAAGACTGGGTGCCCCGAGCTCTGCTCCTGTGAAGGAGTTTGCCACAATTGTTGATGTGAAAGAAGAA

TCTCACTATATCCTGGATCCCAAACAAGCCCTCATGAAGTTCACTCTAGGTACTGTGGGTGGTTTGCCCTCCTCCGCATAATCAGCTTTACTTAGCTTAA

GAGCTGTCATTTGCACTGATGGTCTCATTATTCCTAATCATGGGGGTGACACCAGCTTCAGAGCTCATGTTAAGTCTTCAGACAACTGATGGAAAAACTG

TCTTTATCTGTTGGTTGGTCAGTTTGAAAAGAAGCTAGTTTGTCCAGGAAATAGAGCAGAAGCTTCTGTCTATCAAAATTTGGTGCAGTTTGTCAGCTAA

CCTGTAGGGGCTAAGAGTCTAAGACTGGCAACTTCTGTCACCTTTCCAAAGCAGAGCAAATGCTAATCACAAGGAACCTGGCTCCCATGCCAGACAAAGT

GGTGAGAGCCTTTCTAGTGGAGTGTGCAGAGGCTGATGGACTTGGCCAGTAATGGCACCACAGTTGAAAGGAGCTGAAGCAGAAAGAAGTGCACTTAGAT

TGTCTTGCTCACTCTTGCTCTATGGGGTTGAATGTATGAGTCTCAGGGCCACCAGGCCCCATTTGTTGTGCTGAACTTTTATAGCATGTTGAAGAAGCCT

GCCTTATCCTCCAGTGCCTACATTGCAATATACAAGTGTTGAGAGCACGTGCAGTTAAAAACCACGGGAGGTGGCCTAAGCCTTTTTACTGTGGGAAAAC

AGCCCAGCGTTGACTCCCAGGGCTTGGCAGCAGCAGCAGCAGCTCATGCTGCCCTGTCCCCAGACTCTGCCGAGGTTTCTGACACGCAACACAAGAAACT

AAGAATTCAAAAGCCTTGTTAGTTCAGCATCACTGGAGGTGCAGGGAGAGCCAATGCTTGCCAAGTGGAGGAAGGAGGAGTGTGATAGTGAGAGGAACTT

GAGCTCTAAGTTTAGAGACTATGAAGACAGGGTGAGCATAGCTCCTTAAGTCCTAGTCCTTTTGTCTGTCCAGGTGAAACGTTCAAATTAGCCACCTTCA

TGAAAGGACTCATGAAATGTTGGTTATTCTGTGTCAAATTATATAGTATAATCACAAGAGCTCTTTGATGCTCAAAGCAAACCTGTGGTCAGCCACTTTA

TGGAGTACAGTTACTCCCAGTTTATGATGTGTTGGTATATTTGGCTTTCTTAAAATGAAACAAATATGTATTTTGTTTTTATGTATATTTTTATTTTATG

CGCATGAGTGTTTTGCTGCATGTCTGTCTGTATACCACATGTGTGCAGTACCTGCCTAGGCCGTAAGAGGATGTCAGGTCCCCTGAATCTGAAGCTACAG

GTGGTTCTGAGCCACTATGTGGGTGCTAAGTATCAAACCTGGGCCCTCTGGAAAAGCAGTCAGTGCTCTTAAGCCATTTCTCTGTCCCCCAAGCATGTGG

TTTATGTTTTATTTTTATTATTCTGTTTTATGTATATGGTATTTTGCCTGCATGTATGTATGGTATCCAGAGAGGCCAGAAGAGGCATTGAATCTCCTGG

AACAGGCGATTGTGAGCTACCATGTAGATGCTGAAAACTGAACCCAGGCCCTCTGAAAGAGCAGCCAGCTATCTCTCCACAGCCCCCAGCTATGTTTTTT

TGTTATTGTGATTTGGTGTTTTTCCTCCTTTGAAACAGGGTCTATCTTAACTTTGGCTTAATAGAACTCACTGTGTAGAGCAAGCTGGCCTCTGCCTCCC

AAGCTCTAGAATTAAAGGTGTGTGCCACCACACCCAAATGAACATGTAAGTTTTAAAGCAAGTGGTGATTGGTTTCTCTGGATTCTGTGAGTAATACTCA

GCTCAGAGAAGCTCATTACACATTGCTTTGAATTTACAGGTTTTCTGAGAGACTCCCTCTTGAGGTTTTAACTCTGCCCAGCAGTTTTCTCTGTTCTAGA

CTTTGTAGCAGATTTGGGAGTGGCTTCAGAATTTAGGCTTCATTCAGATTAGGAAGCCATGGTTTCACAGTTCAAAACTATGGCCAGTTAAGTTTTGCTG

AGCTATGATAAAGACATGTTTTTAGTGTTCACGCACTCTCCCTATCTCCCGCTTCTACATTATGAGTCACTGCTAAGACCTCCATTGGAGGGAGTTGGAA

GAAGGGAAGTTTATAGACTAGTGCTGCTTCACTGAGGCAGAGGGCTCTGAGATGTGGCATTGGTGGCAAGGGTGAGATTGTTGGTGTAAGTTAAGACTTT

TTTACTTACAGGTTTATTTATACATTTTTCACTATGTATAATTGTTTGTTTTTGTTAGCTTTTTAAAAAAGGAAACTTAAAGAACTTTAATAAAGGAAAC

AAAAAGC
Translation
MSECGGRGGGGGNNSEDAEDEGGGPKGSGSLSPAGAAASLEGRIRRGLRGASLMARQRPELLCGAVALGCALLFALKFTCS - UNI23816 - SRAKD

VIIPAKPPVSFFSSRSPVLDLFQGQLDYADHVRQDSEVVVLFFYAPWCGQSIAARAEIEQAASRLSDQ VLFVAINCWWNQGKCRKQKHFFYFPVIHLYH

RS SFGPIEYKGPMSAVYIEKFVRRAMKPLLYIPSQSALLDFLSSYE - UNI35556 - PGVLGYFEFSGSPQPPGYLTFFTSALHSLKKD - UNI3

5556 - DYLGTVRFGVITDKHLARLVSLVHSGSVYLHRHFNTSL - UNI35556 - VFPREVMNFTAENIYKWASENQETLFRWLQPHGGKSLLLNN

ELKKGPALFLFIPFDPLAERHPLLDE ITEVALEYNNCHGDQVVERLLQHLRRVEAPVLQSLAPELPASLPDTQLMAASPCCNTVVLPQGPALSRTHNVC

ELCVNQTVGGTRPSSVSVPQCSFFEMAAALDSFYLKEQTFYHVVSGSIECSNFLTSYSPFSYYTACCRTISRGMASFTGSEQNVLTAPAIEFSSLEKSCE

ATAPSSIPHIEENRYRFPQVGLTSTAFTGLSCRTNKTLNIYLLDSNLFWLYAERLGAPSSAPVKEFATIVDVKEESHYILDPKQALMKFTLGTVGGLPSS

A
Transcript ENSMUST00000038424
Sequence
GGCCGGGTCCCCGGGCCCGAGGTGGCGGCAGCGACGGTATAAAGCCGGCCACGGGGAGCATGTAATGTCGGAATGCGGAGGCCGCGGCGGCGGCGGCGGG

AACAACAGCGAGGACGCCGAGGACGAGGGTGGCGGCCCCAAGGGCTCAGGCTCCCTCAGCCCTGCCGGGGCGGCGGCGTCCTTGGAGGGCCGGATCCGCC

GCGGCTTGCGCGGCGCCTCGCTTATGGCGCGCCAGCGGCCAGAGCTGCTGTGCGGGGCCGTGGCTCTCGGCTGCGCCCTGCTCTTCGCCCTCAAGTTCAC

TTGCAG - UNI23816 - TCGAGCAAAAGACGTGATAATACCAGCAAAGCCGCCTGTCAGCTTTTTCTCCTCGAGATCTCCGGTCCTTGACCTCTTCC

AGGGGCAGCTGGACTATGCTGACCATGTCCGCCAGGATTCTGAGGTGGTGGTGCTGTTCTTCTATGCCCCGTGGTGTGGCCAGTCCATCGCTGCCAGGGC

AGAAATTGAGCAGGCAGCCAGCCGGCTTTCTGATCAG GTGTTGTTTGTGGCAATAAACTGTTGGTGGAACCAGGGGAAATGCAGAAAACAGAAGCATTT

CTTCTATTTTCCTGTGATACATCTGTATCATCGGAG TTTTGGACCAATCGAATACAAAGGCCCCATGAGTGCTGTTTACATTGAGAAGTTTGTCCGCCG

GGCGATGAAGCCGCTTCTCTACATCCCGTCTCAATCAGCATTGCTAGACTTTCTCTCCAGCTATGAG - UNI35556 - CCTGGAGTACTCGGATACT

TTGAATTCAGCGGTTCACCCCAGCCTCCTGGTTACTTGACCTTCTTCACCTCAGCACTGCATTCGTTAAAGAAAG - UNI35556 - ATTACCTAGGA

ACAGTGCGATTTGGGGTTATCACAGATAAACACCTTGCGAGACTGGTATCCTTAGTGCACTCTGGAAGTGTGTATTTACATAGACATTTCAACACATCAC

TT - UNI35556 - GTCTTCCCCAGGGAAGTCATGAACTTCACAGCTGAGAACATCTATAAGTGGGCCTCAGAAAACCAGGAGACCCTCTTCCGATGG

CTACAGCCTCATGGAGGCAAGAGTCTGCTGTTGAACAATGAGCTGAAGAAAGGACCAGCACTCTTCCTGTTCATACCGTTTGATCCCCTAGCCGAGAGAC

ATCCTCTTCTAGATGAG ATCACCGAAGTGGCCTTGGAATACAATAACTGTCATGGGGACCAGGTGGTAGAGCGCCTCCTTCAGCACCTGCGGCGGGTAG

AGGCACCTGTGCTCCAGTCCCTGGCACCAGAGCTGCCAGCTTCACTGCCTGATACTCAGCTGATGGCAGCATCCCCCTGCTGTAACACGGTGGTGCTGCC

ACAGGGGCCAGCCCTCTCCAGGACTCACAATGTCTGTGAGCTGTGTGTCAACCAGACAGTGGGTGGTACCAGGCCTAGCTCAGTGAGTGTGCCACAGTGC

AGCTTCTTCGAGATGGCAGCCGCTCTGGATTCTTTCTACCTCAAGGAGCAGACTTTTTATCATGTGGTGTCGGGCAGCATAGAATGCAGCAATTTTTTAA

CCTCCTATAGCCCTTTCAGCTACTACACTGCATGTTGCAGGACCATATCCCGGGGCATGGCAAGCTTTACTGGCTCTGAACAGAATGTCTTGACAGCCCC

AGCCATCGAGTTCTCTTCCTTAGAGAAGAGCTGTGAGGCCACTGCCCCGAGCTCCATTCCTCACATTGAGGAGAACAGGTACCGCTTTCCTCAAGTGGGC

CTCACTAGCACAGCCTTCACGGGCCTGAGCTGCAGAACCAACAAGACCCTGAACATCTACCTTTTGGATTCCAATTTATTTTGGTTATATGCAGAAAGAC

TGGGTGCCCCGAGCTCTGCTCCTGTGAAGGAGTTTGCCACAATTGTTGATGTGAAAGAAGAATCTCACTATATCCTGGATCCCAAACAAGCCCTCATGAA

GTTCACTCTAG AGTCTTTTATTCAAAACTTCAGTGTTCTCTACAGCCCCTTGAAAAGGCATCTCACTGGAAGTGATTCTGCTCAGTTTCCCACTCAGCA

TTTGATCACGGAAGTGACGACTGATACCTTCTGGGAAGTAACCCTTCGGAAACAG GACGTTCTGCTGCTCTATTATACACAGTGGTGTGGCTTTTGCCC

GTCTCTCAATCACATCTTCATCCAGCTAGCTCGGCTCCTGCCAGAGGACACATTTACTGTGGCCAG GATCGACGTGTCTCAGAATGATCTTCCTTGGGA

ATTCATGGTTGACCGTCTTCCTACCGTTTTGTTTTTTCCCTGCAATAG AAAGGACCTAAGTGTGAAATACCCTGGAGACCTCCCTATCACCCTCCCGAA

TCTGCTGCGGTTCATTCTGCATCACTCAGACGCTGCCTCTGCCCCCCAGGACCCTGGCATCAGCCCTCCTACCCAAGACTGTGTCCAGAGCAAGGCAGTG

CTGCAGCGCGAACACATCTCTCACGTGGAGAATGCGATGCAGAAGCTGAGATCTGAGATGAGCAGCCTACGCCGTACACAGGAGCAGGTGGAGGGCAGGC

TCCTTAGTGCCCGCAGGGATGGGCACCGCCTGCTGCGCCGGCAGCGGACCCTGGAGCAGCAGCACAGGCTACTCCGGCGCCACAGCCAGAAACTGCAGGC

TCTGTATTTAAAGAAGGCGCGAGAGCTCCAAGAGCTGGCTAGAGCCTCAGGAACCCCCCTCCCCGAGCACACATGGCTCAAGATCCTTGTGGCCACTATG

GAGAGGGAGCTGGAAGGCCAAGGTGGGGCTAAGGAACCAGCCCCTCTGGGAAAGGCTCGACCGAACCACTCCAAGTCCATGGGTACAACTCAGTTACCTG

GTGACACCCCTCCGCCCTCCACCACCAGCTCCACTTTGGCTTCAGAGACGAAGCATGAGAATAGGACAGACTAACTTTTGAAGGAGCCAGAGGTGAAGAC

TGTACATTGGGAATATAGTTATGCAAATTTTATTGAAATTTATTGTAAATAAAGATCTTTCTCAGTGGTCT
Translation
MSECGGRGGGGGNNSEDAEDEGGGPKGSGSLSPAGAAASLEGRIRRGLRGASLMARQRPELLCGAVALGCALLFALKFTCS - UNI23816 - SRAKD

VIIPAKPPVSFFSSRSPVLDLFQGQLDYADHVRQDSEVVVLFFYAPWCGQSIAARAEIEQAASRLSDQ VLFVAINCWWNQGKCRKQKHFFYFPVIHLYH

RS SFGPIEYKGPMSAVYIEKFVRRAMKPLLYIPSQSALLDFLSSYE - UNI35556 - PGVLGYFEFSGSPQPPGYLTFFTSALHSLKKD - UNI3

5556 - DYLGTVRFGVITDKHLARLVSLVHSGSVYLHRHFNTSL - UNI35556 - VFPREVMNFTAENIYKWASENQETLFRWLQPHGGKSLLLNN

ELKKGPALFLFIPFDPLAERHPLLDE ITEVALEYNNCHGDQVVERLLQHLRRVEAPVLQSLAPELPASLPDTQLMAASPCCNTVVLPQGPALSRTHNVC

ELCVNQTVGGTRPSSVSVPQCSFFEMAAALDSFYLKEQTFYHVVSGSIECSNFLTSYSPFSYYTACCRTISRGMASFTGSEQNVLTAPAIEFSSLEKSCE

ATAPSSIPHIEENRYRFPQVGLTSTAFTGLSCRTNKTLNIYLLDSNLFWLYAERLGAPSSAPVKEFATIVDVKEESHYILDPKQALMKFTLE ESFIQNF

SVLYSPLKRHLTGSDSAQFPTQHLITEVTTDTFWEVTLRKQ DVLLLYYTQWCGFCPSLNHIFIQLARLLPEDTFTVAR RIDVSQNDLPWEFMVDRLPT

VLFFPCNR RKDLSVKYPGDLPITLPNLLRFILHHSDAASAPQDPGISPPTQDCVQSKAVLQREHISHVENAMQKLRSEMSSLRRTQEQVEGRLLSARRD

GHRLLRRQRTLEQQHRLLRRHSQKLQALYLKKARELQELARASGTPLPEHTWLKILVATMERELEGQGGAKEPAPLGKARPNHSKSMGTTQLPGDTPPPS

TTSSTLASETKHENRTD

For any suggestions or comments, please send an email to unitrap@crg.es